Project name: jrk_2VY0_static

Status: done

Started: 2026-03-13 21:07:31
Chain sequence(s) A: MVPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:25)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aa8ca2530185fb2/tmp/folded.pdb                (00:04:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:34)
Show buried residues

Minimal score value
-3.1401
Maximal score value
1.8726
Average score
-0.6088
Total score value
-160.7275

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
34 M A 1.0110
35 V A 0.5354
36 P A -0.3830
37 E A -1.4092
38 V A -0.6820
39 I A -1.1104
40 E A -2.2054
41 I A -1.1716
42 D A -1.1968
43 G A -1.4674
44 K A -1.3485
45 Q A -1.3386
46 W A 0.0000
47 R A -1.3162
48 L A -0.1660
49 I A 0.8047
50 W A 0.0000
51 H A 0.0448
52 D A 0.0000
53 E A -0.9201
54 F A 0.0000
55 E A -2.6480
56 G A -2.0564
57 S A -1.6410
58 E A -2.3569
59 V A -1.9353
60 N A -2.3464
61 K A -2.7975
62 E A -2.7935
63 Y A -1.8793
64 W A 0.0000
65 T A -1.2166
66 F A -1.0249
67 E A 0.0000
68 K A -1.8992
69 G A 0.0000
70 N A 0.0000
71 G A 0.0000
72 I A 0.4942
73 A A 0.3308
74 Y A 1.1754
75 G A 0.6696
76 I A 1.1138
77 P A 0.3990
78 G A 0.0000
79 W A 0.0000
80 G A -0.0370
81 N A 0.1630
82 G A 0.1358
83 E A 0.0000
84 L A 0.4451
85 E A 0.0000
86 Y A 0.0000
87 Y A 0.0000
88 T A -1.7449
89 E A -2.4420
90 N A -1.9585
91 N A 0.0000
92 T A 0.0000
93 Y A -0.1365
94 I A 0.0000
95 V A -0.2464
96 N A -1.3678
97 G A -1.4151
98 T A -0.7354
99 L A 0.0000
100 V A 0.0000
101 I A 0.0000
102 E A -0.9004
103 A A 0.0000
104 R A -1.0996
105 K A -1.4162
106 E A -0.2700
107 I A 1.8726
108 I A 1.2019
109 T A 0.3156
110 D A -0.8247
111 P A -1.0999
112 N A -1.5781
113 E A -1.0369
114 G A -0.6717
115 T A 0.4737
116 F A 1.0940
117 L A 1.3484
118 Y A 0.3968
119 T A 0.0000
120 S A 0.0000
121 S A 0.0000
122 R A -0.6822
123 L A 0.0000
124 K A 0.0000
125 T A 0.0000
126 E A -1.1209
127 G A -1.5638
128 K A -2.1916
129 V A -1.5843
130 E A -2.2525
131 F A 0.0000
132 S A -1.3667
133 P A 0.0000
134 P A -0.1564
135 V A 0.0000
136 V A 0.0000
137 V A 0.0000
138 E A -0.4868
139 A A 0.0000
140 R A -1.0514
141 I A 0.0000
142 K A -1.4150
143 L A 0.0000
144 P A 0.0000
145 K A -2.6098
146 G A 0.0000
147 K A -2.0455
148 G A 0.0000
149 L A 0.0000
150 W A 0.0000
151 P A 0.0000
152 A A 0.0000
153 F A 0.0000
154 W A 0.0338
155 M A 0.0000
156 L A 0.0000
157 G A 0.0000
158 S A -1.4021
159 N A -1.4670
160 I A -1.2105
161 R A -2.4275
162 E A -2.4331
163 V A -0.8137
164 G A -0.7712
165 W A -0.0778
166 P A -0.1273
167 N A -1.0110
168 C A 0.0000
169 G A 0.0000
170 E A -0.1633
171 I A 0.0000
172 D A 0.0000
173 I A 0.0000
174 M A 0.0000
175 E A -0.2547
176 F A 0.0000
177 L A -0.7522
178 G A 0.0000
179 H A -1.8364
180 E A -2.0239
181 P A -1.7315
182 R A -1.4883
183 T A 0.0000
184 I A 0.0000
185 H A -0.7326
186 G A 0.0000
187 T A 0.0000
188 V A 0.0000
189 H A 0.0000
190 G A 0.0000
191 P A -0.9276
192 G A -0.9222
193 Y A 0.0000
194 S A -0.9281
195 G A -0.8864
196 S A -0.9825
197 K A -1.8694
198 G A -1.1335
199 I A -0.7506
200 T A -1.2365
201 R A -1.8206
202 A A -0.8414
203 Y A -0.3103
204 T A -0.7480
205 L A 0.0000
206 P A -1.1698
207 E A -2.0442
208 G A -1.0975
209 V A -0.6200
210 P A -1.1923
211 D A 0.0000
212 F A 0.0000
213 T A -2.1079
214 E A -2.6113
215 D A -1.9501
216 F A -0.9788
217 H A 0.0000
218 V A -0.8212
219 F A 0.0000
220 G A 0.0000
221 I A 0.0000
222 V A 0.0000
223 W A 0.0000
224 Y A -0.7849
225 P A -1.6693
226 D A -2.1113
227 K A -1.9567
228 I A 0.0000
229 K A -0.8814
230 W A 0.0000
231 Y A 0.0000
232 V A 0.0000
233 D A -1.8894
234 G A -1.1574
235 T A -0.4799
236 F A -0.1143
237 Y A 0.0000
238 H A -1.0677
239 E A -1.6200
240 V A 0.0000
241 T A -2.1843
242 K A -3.1401
243 E A -3.1196
244 Q A -2.0841
245 V A 0.0000
246 E A -2.9964
247 A A -1.5095
248 M A -0.5247
249 G A -1.1893
250 Y A -1.4207
251 E A -2.3141
252 W A 0.0000
253 V A -1.4795
254 F A 0.0000
255 D A -2.7268
256 K A -2.3627
257 P A -1.6330
258 F A 0.0000
259 Y A 0.0000
260 I A 0.0000
261 I A 0.0000
262 L A 0.0000
263 N A 0.0000
264 L A 0.0000
265 A A 0.0000
266 V A 0.0000
267 G A 0.0000
268 G A 0.3925
269 Y A 1.2998
270 W A 1.2842
271 P A 0.0000
272 G A -0.3426
273 N A -1.3231
274 P A 0.0000
275 D A -1.3656
276 A A -0.4724
277 T A -0.7173
278 T A -1.2424
279 P A -0.9584
280 F A -0.8031
281 P A -0.9336
282 A A 0.0000
283 K A -1.3699
284 M A 0.0000
285 V A -0.2209
286 V A 0.0000
287 D A -0.8459
288 Y A 0.0000
289 V A 0.0000
290 R A 0.0000
291 V A 0.0000
292 Y A 0.0000
293 S A 0.3933
294 F A 0.7586
295 V A 0.8461
296 S A -0.3702
297 G A -0.8864
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.2683 3.2645 View CSV PDB
4.5 -0.3341 3.2645 View CSV PDB
5.0 -0.4188 3.2645 View CSV PDB
5.5 -0.5063 3.2645 View CSV PDB
6.0 -0.5797 3.2645 View CSV PDB
6.5 -0.6244 3.2645 View CSV PDB
7.0 -0.6355 3.2645 View CSV PDB
7.5 -0.6218 3.2644 View CSV PDB
8.0 -0.5949 3.2642 View CSV PDB
8.5 -0.561 3.2635 View CSV PDB
9.0 -0.5221 3.2614 View CSV PDB