Project name: RFA139_protenix

Status: done

Started: 2026-06-15 02:31:59
Chain sequence(s) A: EVQLVESGGGLEQPGGSLRLSCAGSGFTFGTKYYGWVRQAPGKGLEWVSSISASGKGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASLSLYTTSTSRGLVGDVWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISCRSSTPNGAIGWYLQKSGQSPQLLIYGGSKRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQTDSGNGTFGQGTKLEIKRTV
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:10)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aa9866285c57bfc/tmp/folded.pdb                (00:02:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:24)
Show buried residues

Minimal score value
-3.3069
Maximal score value
1.3238
Average score
-0.6981
Total score value
-164.7572

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.6078
2 V A -0.2268
3 Q A -0.5999
4 L A 0.0000
5 V A 0.8360
6 E A 0.0000
7 S A -0.4522
8 G A -0.9828
9 G A -0.4914
10 G A 0.1231
11 L A 0.8865
12 E A -0.5726
13 Q A -1.5761
14 P A -1.6487
15 G A -1.4300
16 G A -1.0143
17 S A -1.0791
18 L A -0.9774
19 R A -2.1083
20 L A 0.0000
21 S A -0.3977
22 C A 0.0000
23 A A -0.1987
24 G A 0.0000
25 S A -0.4987
26 G A -0.7144
27 F A -0.1260
28 T A -0.1540
29 F A 0.0000
30 G A -0.9452
31 T A -0.3432
32 K A -0.2178
33 Y A 0.2517
34 Y A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8989
40 A A -1.2650
41 P A -1.0343
42 G A -1.4722
43 K A -2.3634
44 G A -1.5340
45 L A 0.0000
46 E A -1.1777
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A -0.4994
53 A A -0.6366
54 S A -1.0706
55 G A -1.3151
56 K A -1.8513
57 G A -0.8832
58 T A -0.1023
59 Y A 0.1982
60 Y A -0.4018
61 A A -1.4405
62 D A -2.5163
63 S A -1.6488
64 V A 0.0000
65 K A -2.3578
66 G A -1.6174
67 R A 0.0000
68 F A 0.0000
69 T A -0.6834
70 I A 0.0000
71 S A -0.6866
72 R A -1.0627
73 D A -1.7854
74 N A -2.0728
75 S A -1.7719
76 K A -2.5061
77 N A -1.8890
78 T A -1.1280
79 L A 0.0000
80 Y A -0.5603
81 L A 0.0000
82 Q A -1.2122
83 M A 0.0000
84 N A -1.3030
85 S A -1.1513
86 L A 0.0000
87 R A -2.2093
88 A A -1.7271
89 E A -2.1908
90 D A 0.0000
91 T A -0.6957
92 A A 0.0000
93 V A -0.0319
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 S A 0.0000
99 L A 0.0000
100 S A 0.6529
101 L A 1.1343
102 Y A 0.6005
103 T A -0.4392
104 T A -0.5846
105 S A -0.5757
106 T A -0.6463
107 S A 0.0000
108 R A -1.7882
109 G A -0.7090
110 L A 0.2421
111 V A 0.0000
112 G A 0.0000
113 D A -0.7749
114 V A -0.1085
115 W A 0.0000
116 G A 0.0000
117 Q A -1.3252
118 G A 0.0000
119 T A -0.2204
120 T A -0.0797
121 V A 0.0000
122 T A -0.1597
123 V A 0.0000
124 S A -0.8165
125 S A -0.5567
126 A A -0.2080
127 S A -0.1862
1 D B -1.6094
2 I B -0.0629
3 V B 0.8874
4 M B 0.0000
5 T B -0.5871
6 Q B 0.0000
7 S B -0.4654
8 P B -0.0312
9 L B 0.5057
10 S B -0.0563
11 L B -0.2967
12 P B -1.3743
13 V B 0.0000
14 T B -1.8707
15 P B -2.0702
16 G B -2.2896
17 E B -2.5835
18 P B -2.2693
19 A B 0.0000
20 S B -0.7893
21 I B 0.0000
22 S B -1.0711
23 C B 0.0000
24 R B -2.2515
25 S B 0.0000
26 S B -0.4553
27 T B -0.4082
28 P B -0.9115
29 N B 0.0000
30 G B -0.9520
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -0.8863
38 K B -1.4130
39 S B -0.9274
40 G B -1.4624
41 Q B -2.1144
42 S B -1.4564
43 P B 0.0000
44 Q B -1.3740
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.6503
49 G B -0.9394
50 G B -0.9846
51 S B -1.4890
52 K B -2.2634
53 R B -2.1134
54 G B -1.4907
55 S B -0.9452
56 G B -0.9552
57 V B 0.0000
58 P B -1.4328
59 D B -2.3144
60 R B -2.3625
61 F B 0.0000
62 S B -1.7376
63 G B -1.2932
64 S B -1.2527
65 G B -1.3447
66 S B -1.2247
67 G B -1.1549
68 T B -1.5736
69 D B -2.2215
70 F B 0.0000
71 T B -1.2563
72 L B 0.0000
73 K B -1.9186
74 I B 0.0000
75 S B -2.4344
76 R B -3.3069
77 V B 0.0000
78 E B -2.8222
79 A B -1.5642
80 E B -2.3123
81 D B 0.0000
82 V B -0.8156
83 G B 0.0000
84 F B 0.0989
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 T B -0.7512
91 D B -1.3457
92 S B -1.2690
93 G B -1.1418
94 N B -0.9562
95 G B -0.4927
96 T B -0.4188
97 F B 0.0000
98 G B 0.0000
99 Q B -1.0868
100 G B 0.0000
101 T B 0.0000
102 K B -0.5725
103 L B 0.0000
104 E B -1.2508
105 I B -1.3589
106 K B -2.5776
107 R B -2.2970
108 T B -0.4696
109 V B 1.3238
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6865 1.4275 View CSV PDB
4.5 -0.7265 1.4008 View CSV PDB
5.0 -0.7726 1.3633 View CSV PDB
5.5 -0.8169 1.3214 View CSV PDB
6.0 -0.8497 1.2815 View CSV PDB
6.5 -0.8636 1.2501 View CSV PDB
7.0 -0.8586 1.2315 View CSV PDB
7.5 -0.8412 1.2234 View CSV PDB
8.0 -0.8167 1.2882 View CSV PDB
8.5 -0.7864 1.4471 View CSV PDB
9.0 -0.7498 1.6062 View CSV PDB