Project name: aab9039dfa31bc8

Status: done

Started: 2026-05-28 17:40:53
Chain sequence(s) A: MGFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDGGGGSCYRCSDCPNPFDKTQITELGNCNFCRTVYTYRDEDNYRIAKDCVASCVPQDRRGGKAGLVTECCDEDYCNASPKHLEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:51)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aab9039dfa31bc8/tmp/folded.pdb                (00:01:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:45)
Show buried residues

Minimal score value
-4.2273
Maximal score value
1.1044
Average score
-1.0918
Total score value
-245.663

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.7167
2 G A -0.5044
3 F A -0.8209
4 D A -1.9935
5 A A -1.7264
6 S A -2.0694
7 N A -2.3116
8 F A 0.0000
9 K A -2.3872
10 D A -1.2927
11 F A 0.0000
12 S A -0.7870
13 S A -0.9370
14 I A 0.0000
15 A A -0.5739
16 S A -0.8781
17 A A -0.5543
18 S A -0.6643
19 S A 0.0000
20 S A -0.0171
21 W A 0.0000
22 Q A -0.7115
23 N A 0.0000
24 Q A -1.7055
25 S A -1.2585
26 G A -1.0710
27 S A 0.0000
28 T A -0.5844
29 M A 0.0000
30 I A -0.0357
31 I A 0.0000
32 Q A -1.6185
33 V A 0.0000
34 D A -0.9618
35 S A 0.1964
36 F A 1.0703
37 G A -0.6289
38 N A -1.1779
39 V A 0.0000
40 S A -1.2260
41 G A -0.7972
42 Q A -0.8232
43 Y A 0.0000
44 V A 0.0000
45 N A 0.0000
46 R A -1.9026
47 A A -1.5805
48 Q A -1.7798
49 G A -1.2738
50 T A -0.9283
51 G A -1.1268
52 C A 0.0000
53 Q A -1.8495
54 N A -1.8361
55 S A 0.0000
56 P A -0.9648
57 Y A 0.0000
58 P A -0.7554
59 L A 0.0000
60 T A -0.9711
61 G A -1.1769
62 R A -1.8622
63 V A -0.8466
64 N A -1.0256
65 G A -0.6821
66 T A -0.0336
67 F A 1.0740
68 I A 0.0000
69 A A -0.3965
70 F A 0.0000
71 S A -0.5971
72 V A 0.0000
73 G A -0.8886
74 W A -1.2935
75 N A -2.0576
76 N A -1.5606
77 S A -1.0272
78 T A -1.2438
79 E A -1.9217
80 N A -2.3738
81 C A -1.5213
82 N A -2.1119
83 S A -1.1145
84 A A -0.4005
85 T A 0.0000
86 G A -0.4616
87 W A 0.0000
88 T A -0.0836
89 G A 0.0000
90 Y A 1.1044
91 A A 0.0000
92 Q A -0.4722
93 V A -1.2137
94 N A -1.7526
95 G A -1.6751
96 N A -2.1801
97 N A -1.5689
98 T A 0.0000
99 E A 0.0000
100 I A 0.0000
101 V A 0.3233
102 T A 0.0000
103 S A -0.9461
104 W A -1.0498
105 N A -1.1803
106 L A -0.4589
107 A A -0.2194
108 Y A -0.6746
109 E A -1.8975
110 G A -1.0728
111 G A -1.0760
112 S A -0.8979
113 G A -1.0551
114 P A -0.7621
115 A A -0.0208
116 I A 0.8099
117 E A -0.8812
118 Q A -1.8385
119 G A -1.7677
120 Q A -1.7979
121 D A -1.1103
122 T A -0.6553
123 F A 0.0000
124 Q A -0.5522
125 Y A 0.1635
126 V A 0.5116
127 P A -0.3056
128 T A -0.5144
129 T A -1.2043
130 E A -2.6167
131 N A -1.9010
132 K A -2.2747
133 S A -1.4487
134 L A 0.1287
135 L A -1.3822
136 K A -2.2575
137 D A -2.6185
138 G A -2.1458
139 G A -1.8722
140 G A -2.3624
141 G A 0.0000
142 S A -1.9077
143 C A 0.0000
144 Y A 0.0000
145 R A -2.1926
146 C A -1.5827
147 S A -1.4818
148 D A -2.3420
149 C A 0.0000
150 P A -1.6651
151 N A -1.7598
152 P A -1.0597
153 F A -1.0680
154 D A -1.6757
155 K A -2.1619
156 T A -1.5635
157 Q A -1.9353
158 I A -1.6926
159 T A -1.6040
160 E A -2.2867
161 L A -1.2158
162 G A -1.6313
163 N A -1.7897
164 C A 0.0000
165 N A -1.8540
166 F A -1.1184
167 C A 0.0000
168 R A -0.7607
169 T A 0.0000
170 V A 0.0000
171 Y A 0.0000
172 T A -1.1882
173 Y A -2.7049
174 R A -3.4787
175 D A -3.8397
176 E A -4.2273
177 D A -3.8244
178 N A -3.5068
179 Y A -2.2881
180 R A -1.9111
181 I A 0.0000
182 A A -1.2748
183 K A 0.0000
184 D A -1.3150
185 C A -1.0274
186 V A -0.3242
187 A A -0.4054
188 S A -0.4867
189 C A 0.0000
190 V A -0.0511
191 P A -0.6215
192 Q A -1.6142
193 D A -3.1159
194 R A -3.3863
195 R A -3.5866
196 G A -2.3050
197 G A -2.2262
198 K A -3.5324
199 A A -2.9431
200 G A -2.4111
201 L A -1.3006
202 V A 0.0000
203 T A 0.0000
204 E A -0.8385
205 C A -0.4987
206 C A 0.0000
207 D A -1.5353
208 E A -2.2988
209 D A -2.4669
210 Y A -1.1737
211 C A -1.0433
212 N A 0.0000
213 A A -0.7083
214 S A -0.5875
215 P A -1.1049
216 K A -2.3051
217 H A -1.8152
218 L A -0.8340
219 E A -2.6650
220 H A -2.7007
221 H A -2.6788
222 H A -2.9039
223 H A -2.6620
224 H A -2.3644
225 H A -1.8827
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8152 3.0203 View CSV PDB
4.5 -0.8844 2.9802 View CSV PDB
5.0 -0.9664 2.9694 View CSV PDB
5.5 -1.0466 2.9584 View CSV PDB
6.0 -1.1098 2.9474 View CSV PDB
6.5 -1.1479 2.9364 View CSV PDB
7.0 -1.1655 2.9256 View CSV PDB
7.5 -1.1728 2.9154 View CSV PDB
8.0 -1.1738 2.9065 View CSV PDB
8.5 -1.1672 2.9001 View CSV PDB
9.0 -1.1513 2.8965 View CSV PDB