Project name: 16 FULL

Status: done

Started: 2026-06-05 10:55:55
Chain sequence(s) A: DIVMTQSPLSLPVTPGEPASISCRSSQSLLNGYNQKNYLTWYLQKPGQSPQLLIYWASTRESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQNDYSYPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNSYYINWVRQAPGQGLEWMGNIYPSDSYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWRGNSFDYWGQGTLVTVSS
B: DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:59)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ac575e064a6c6c7/tmp/folded.pdb                (00:03:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:00)
Show buried residues

Minimal score value
-3.5935
Maximal score value
3.0551
Average score
-0.5824
Total score value
-174.1406

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.5059
2 I A -0.3377
3 V A 0.6673
4 M A 0.0000
5 T A -0.5852
6 Q A 0.0000
7 S A -0.2758
8 P A 0.0928
9 L A 0.6771
10 S A -0.1082
11 L A -0.3672
12 P A -1.1370
13 V A 0.0000
14 T A -1.7552
15 P A -1.9138
16 G A -1.9751
17 E A -2.4640
18 P A -2.2680
19 A A 0.0000
20 S A -0.8787
21 I A 0.0000
22 S A -1.0263
23 C A 0.0000
24 R A -2.3963
25 S A 0.0000
26 S A -0.9806
27 Q A -1.5467
28 S A -1.0171
29 L A 0.0000
30 L A -0.3381
31 N A 0.0000
32 G A -0.3877
33 Y A -0.2929
34 N A -1.1262
35 Q A -1.5472
36 K A -1.2946
37 N A 0.0000
38 Y A 0.0000
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 L A 0.0000
44 Q A 0.0000
45 K A -1.5416
46 P A -1.1289
47 G A -1.4978
48 Q A -2.0667
49 S A -1.3097
50 P A 0.0000
51 Q A -1.1072
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.5209
57 A A 0.0000
58 S A -0.7600
59 T A -0.7426
60 R A -1.6927
61 E A -1.1793
62 S A -0.8426
63 G A -1.1807
64 V A 0.0000
65 P A -1.4562
66 D A -2.3131
67 R A -2.2740
68 F A 0.0000
69 S A -1.5577
70 G A -0.9771
71 S A -0.9470
72 G A -1.1560
73 S A -1.1652
74 G A -1.0591
75 T A -1.7255
76 D A -2.4114
77 F A 0.0000
78 T A -1.2612
79 L A 0.0000
80 K A -2.1286
81 I A 0.0000
82 S A -2.4446
83 R A -3.1770
84 V A 0.0000
85 E A -2.2637
86 A A -1.5044
87 E A -1.9074
88 D A 0.0000
89 V A -0.8700
90 G A 0.0000
91 V A -0.3560
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A 0.0572
99 S A -0.2863
100 Y A -0.2421
101 P A -0.7163
102 F A 0.0000
103 T A -0.0025
104 F A 0.0971
105 G A 0.0000
106 Q A -1.1080
107 G A 0.0000
108 T A 0.0000
109 K A -0.9322
110 L A 0.0000
111 E A -1.7408
112 I A -1.7675
113 K A -2.3568
114 G A -1.8113
115 G A -1.7295
116 G A -1.3629
117 G A -1.2125
118 S A -1.2126
119 G A -1.3526
120 G A -1.6447
121 G A -1.4336
122 G A -1.3689
123 S A -1.2714
124 G A -1.2214
125 G A -1.2668
126 G A -1.3285
127 G A -1.4055
128 S A -1.2996
129 Q A -1.7834
130 V A 0.0000
131 Q A -1.4552
132 L A 0.0000
133 V A 0.3847
134 Q A 0.0000
135 S A -0.4868
136 G A -0.4595
137 A A 0.2184
138 E A -0.0583
139 V A 0.9978
140 K A -0.8621
141 K A -2.0339
142 P A -2.0514
143 G A -1.4530
144 A A -1.1706
145 S A -1.3470
146 V A 0.0000
147 K A -2.1368
148 V A 0.0000
149 S A -0.6270
150 C A 0.0000
151 K A -0.9204
152 A A 0.0000
153 S A -0.7895
154 G A -0.9155
155 Y A -0.4425
156 T A -0.2629
157 F A 0.0000
158 N A -1.1966
159 S A -0.3125
160 Y A 0.1320
161 Y A 0.2922
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A 0.0000
167 Q A -0.5079
168 A A -0.9061
169 P A -0.7407
170 G A -1.2133
171 Q A -1.8498
172 G A -1.2819
173 L A 0.0000
174 E A -0.6931
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A -0.1575
181 P A 0.0000
182 S A -1.1652
183 D A -1.6564
184 S A -0.6366
185 Y A 0.6810
186 T A 0.3760
187 N A -0.1308
188 Y A -1.2778
189 N A -2.0329
190 Q A -3.1659
191 K A -3.1033
192 F A 0.0000
193 K A -3.5935
194 D A -3.3025
195 R A -2.3353
196 V A 0.0000
197 T A -1.1507
198 M A 0.0000
199 T A -0.3401
200 R A -1.2705
201 D A -1.1353
202 T A -0.8257
203 S A -0.5397
204 T A -0.6581
205 S A -0.8676
206 T A 0.0000
207 V A 0.0000
208 Y A -0.7967
209 M A 0.0000
210 E A -1.6100
211 L A 0.0000
212 S A -1.3232
213 S A -1.2786
214 L A 0.0000
215 R A -2.6801
216 S A -2.1918
217 E A -2.4008
218 D A 0.0000
219 T A -0.6705
220 A A 0.0000
221 V A 0.5243
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 S A 0.0000
228 W A 0.1851
229 R A -0.4959
230 G A 0.0000
231 N A 0.0000
232 S A 0.0000
233 F A 0.0000
234 D A -0.2008
235 Y A -0.1509
236 W A -0.3302
237 G A 0.0000
238 Q A -1.1772
239 G A -0.3440
240 T A 0.0000
241 L A 0.8815
242 V A 0.0000
243 T A -0.0805
244 V A 0.0000
245 S A -0.7806
246 S A -0.9366
1 D B -2.3809
2 Q B -2.0126
3 W B -0.6355
4 S B -0.9383
5 T B -0.8411
6 Q B -1.4691
7 D B -2.0422
8 L B -0.3814
9 Y B -0.2565
10 N B -1.4358
11 N B 0.0000
12 P B -0.7100
13 V B 0.0000
14 T B 0.0000
15 A B -0.9315
16 V B 0.0000
17 F B -0.6238
18 N B -0.4571
19 Y B -0.5410
20 Q B -1.5570
21 G B -0.6741
22 L B 0.6933
23 W B 1.0251
24 R B -0.5675
25 S B 0.0000
26 C B 0.0000
27 V B 0.0000
28 R B -0.7326
29 E B 0.0000
30 S B 0.0000
31 S B 0.0000
32 G B -0.1956
33 F B -0.0262
34 T B -0.6505
35 E B -1.3904
36 C B -0.9997
37 R B -1.3623
38 G B -0.1468
39 Y B 1.6847
40 F B 2.7517
41 T B 2.6422
42 L B 3.0551
43 L B 2.8128
44 G B 1.6334
45 L B 2.2763
46 P B 1.1656
47 A B 0.9595
48 M B 1.6181
49 L B 1.9263
50 Q B 0.1511
51 A B 0.4048
52 V B 0.7767
53 R B -1.1451
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4063 5.3853 View CSV PDB
4.5 -0.4485 5.3853 View CSV PDB
5.0 -0.497 5.3853 View CSV PDB
5.5 -0.5443 5.3853 View CSV PDB
6.0 -0.5826 5.3853 View CSV PDB
6.5 -0.6054 5.3853 View CSV PDB
7.0 -0.6117 5.3852 View CSV PDB
7.5 -0.6065 5.3851 View CSV PDB
8.0 -0.5938 5.3848 View CSV PDB
8.5 -0.574 5.3837 View CSV PDB
9.0 -0.547 5.3804 View CSV PDB