Project name: ac974c6aaeaa7ea [mutate: KR109A]

Status: done

Started: 2026-04-07 23:23:42
Chain sequence(s) A: MPSACANGWIQYDKHCYLDTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKDIDISKLTNFKQLNSTTDSEACYIYKSGKLVKTVCKSTQSVLCVKRFYK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Mutated residues KR109A
Energy difference between WT (input) and mutated protein (by FoldX) 0.102536 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:08)
[INFO]       FoldX:    Building mutant model                                                       (00:04:20)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:35)
Show buried residues

Minimal score value
-3.9695
Maximal score value
1.6096
Average score
-1.0563
Total score value
-133.0965

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.8793
2 P A 0.1633
3 S A -0.1407
4 A A -0.6009
5 C A 0.0000
6 A A -0.4474
7 N A -1.3185
8 G A -0.9380
9 W A -0.3630
10 I A 0.1448
11 Q A -1.3915
12 Y A -0.8761
13 D A -1.8949
14 K A -2.5551
15 H A -1.8901
16 C A 0.0000
17 Y A 0.0000
18 L A -0.1582
19 D A -0.1174
20 T A -0.4089
21 N A -0.8271
22 I A 0.2553
23 K A -1.3065
24 M A -1.3831
25 S A -1.6270
26 T A 0.0000
27 D A -2.1787
28 N A -2.0554
29 A A 0.0000
30 V A 0.0000
31 Y A -0.9767
32 Q A -1.2820
33 C A 0.0000
34 R A -2.8194
35 K A -2.6115
36 L A -1.8170
37 R A -3.0859
38 A A 0.0000
39 R A -2.4112
40 L A 0.0000
41 P A 0.0000
42 R A -1.2188
43 P A 0.0000
44 D A -1.6121
45 T A -1.5332
46 R A -2.3277
47 H A 0.0000
48 L A 0.0000
49 R A -2.0067
50 V A -0.1483
51 L A 0.0000
52 F A 0.7959
53 S A 0.7293
54 I A 1.2840
55 F A 1.3249
56 Y A 1.6096
57 K A 0.0621
58 D A -0.8210
59 Y A 0.0000
60 W A 0.0000
61 V A 0.0000
62 S A 0.0000
63 L A 0.0000
64 K A -1.4947
65 K A -2.5324
66 T A -2.7171
67 N A -3.2667
68 D A -3.3641
69 K A -3.6649
70 W A -2.8507
71 L A -2.6472
72 D A 0.0000
73 I A 0.0000
74 N A -1.9840
75 N A -2.6937
76 D A -3.4295
77 K A -3.9695
78 D A -3.7343
79 I A -2.7298
80 D A -2.8656
81 I A 0.0000
82 S A -1.9114
83 K A -2.2354
84 L A 0.0000
85 T A -1.0915
86 N A -1.5652
87 F A -1.8462
88 K A -2.6164
89 Q A -2.6686
90 L A 0.0000
91 N A -2.2487
92 S A -1.6957
93 T A -1.7466
94 T A -1.2060
95 D A -1.9520
96 S A -2.4720
97 E A -2.8681
98 A A 0.0000
99 C A 0.0000
100 Y A 0.0000
101 I A 0.0000
102 Y A 0.0000
103 K A -1.8490
104 S A -1.3322
105 G A -1.5599
106 K A -2.1067
107 L A 0.0000
108 V A -1.3380
109 R A -1.7737 mutated: KR109A
110 T A -0.3603
111 V A 0.5991
112 C A -0.7898
113 K A -1.5736
114 S A -0.5596
115 T A -0.7748
116 Q A -0.7966
117 S A 0.0000
118 V A 0.0000
119 L A 0.0000
120 C A 0.0000
121 V A 0.0000
122 K A -1.9621
123 R A -2.5917
124 F A -1.1193
125 Y A -0.0584
126 K A -1.1804
Download PDB file
View in 3Dmol