Project name: Feng

Status: done

Started: 2026-07-16 06:33:10
Chain sequence(s) B: AVQLVESGGGLVQPGGSLRLSCTASGSILSFNSMGWHRQAPGRQRELVAGISIHKTSSNYANFVKGRFTISRDDAKNTVYLQMNSLKPEDTAVYYCAAVQRYQRRISYWGQGTQVTVSS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:06)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ace32d3f8914f05/tmp/folded.pdb                (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:35)
Show buried residues

Minimal score value
-3.0577
Maximal score value
1.0682
Average score
-0.7472
Total score value
-88.9199

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A B -0.0286
2 V B -0.1392
3 Q B -0.6522
4 L B 0.0000
5 V B 1.0682
6 E B -0.0013
7 S B -0.4833
8 G B -1.0992
9 G B -0.7543
10 G B -0.0256
11 L B 0.9485
12 V B 0.0000
13 Q B -1.4288
14 P B -1.6071
15 G B -1.3786
16 G B -0.9182
17 S B -1.1542
18 L B -0.7342
19 R B -1.7691
20 L B 0.0000
21 S B -0.3816
22 C B 0.0000
23 T B -0.3029
24 A B 0.0000
25 S B -0.5173
26 G B -0.6177
27 S B -0.4967
28 I B 0.0000
29 L B -0.2768
30 S B -0.4381
31 F B 0.0000
32 N B -2.1394
33 S B -0.9989
34 M B 0.0000
35 G B 0.0000
36 W B 0.0000
37 H B 0.1805
38 R B 0.0000
39 Q B -1.4745
40 A B -1.5898
41 P B -1.1800
42 G B -1.6239
43 R B -2.5494
44 Q B -2.5809
45 R B -1.8091
46 E B -0.7148
47 L B 0.7433
48 V B 0.0000
49 A B 0.0000
50 G B -0.2469
51 I B -0.8304
52 S B -1.3046
53 I B 0.0000
54 H B -1.8055
55 K B -2.2828
56 T B -1.1278
57 S B -1.1052
58 S B -0.9588
59 N B -1.4529
60 Y B -0.8546
61 A B -0.5527
62 N B -1.4055
63 F B -0.1811
64 V B 0.0000
65 K B -2.2102
66 G B -1.5126
67 R B -1.1761
68 F B 0.0000
69 T B -0.9541
70 I B 0.0000
71 S B -0.5284
72 R B -1.2213
73 D B -1.5850
74 D B -1.5793
75 A B -1.3860
76 K B -2.2927
77 N B -1.5687
78 T B 0.0000
79 V B 0.0000
80 Y B -0.5989
81 L B 0.0000
82 Q B -1.0823
83 M B 0.0000
84 N B -1.3533
85 S B -1.1912
86 L B 0.0000
87 K B -2.3244
88 P B -1.9475
89 E B -2.2050
90 D B 0.0000
91 T B -0.9177
92 A B 0.0000
93 V B -0.4417
94 Y B 0.0000
95 Y B -0.0528
96 C B 0.0000
97 A B 0.0000
98 A B 0.0000
99 V B -1.1033
100 Q B -1.5224
101 R B -1.6241
102 Y B -0.6133
103 Q B -2.2454
104 R B -3.0577
105 R B -2.4617
106 I B -0.5006
107 S B -0.5360
108 Y B 0.2997
109 W B 0.5668
110 G B -0.0369
111 Q B -0.8643
112 G B -0.5596
113 T B -0.7272
114 Q B -0.9860
115 V B 0.0000
116 T B -0.3688
117 V B 0.0000
118 S B -0.8538
119 S B -0.5621
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.963 1.6857 View CSV PDB
4.5 -0.9775 1.6836 View CSV PDB
5.0 -0.991 1.6812 View CSV PDB
5.5 -0.9982 1.6786 View CSV PDB
6.0 -0.9942 1.6753 View CSV PDB
6.5 -0.9769 1.6721 View CSV PDB
7.0 -0.948 1.6699 View CSV PDB
7.5 -0.9118 1.6688 View CSV PDB
8.0 -0.8721 1.6685 View CSV PDB
8.5 -0.83 1.6683 View CSV PDB
9.0 -0.7862 1.6682 View CSV PDB