Project name: PfHAase [mutate: DR148A, GA82A, GA42A, CA153A, NA210A] [mutate: MA1A]

Status: done

Started: 2026-06-24 16:13:16
Chain sequence(s) A: MYTLHWDVNSSNFLDYFVFDTEADPTAGFVKYVDQSTASNDALYSTSNNQIYLGVDKTTVLDSSSTGRNSVRVYSQNTFSSAILITDFAHLPVSVCGIWPAYWTINNQANPYGEIDIMEAYDDVAGAYVSLHTSNTCTLSNRNFTGTRTRTDATLSSGGGCGVQSTSSQFGAGFNAAGGGVWVLSLENSLQLWVFPRNQIPADITNGSPAPSSWGTPLFEFDSNNGCDVSSNFIDQTVIFNLDFCGQNGAGGQEWSDWTDCATTTGQSTCNAYVAANPSAYSETYFSINSIKLYQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues MA1A
Energy difference between WT (input) and mutated protein (by FoldX) 0.157581 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:38)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:43)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/acfaf657a1fafd2/tmp/folded.pdb                (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:10)
Show buried residues

Minimal score value
-2.6009
Maximal score value
1.2518
Average score
-0.5904
Total score value
-174.1656

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A A 0.0757 mutated: MA1A
2 Y A 0.1855
3 T A 0.1536
4 L A 0.2906
5 H A -0.6945
6 W A 0.0000
7 D A -1.0746
8 V A 0.0000
9 N A -0.9265
10 S A -0.9207
11 S A -0.8238
12 N A -0.8539
13 F A 0.0000
14 L A 0.1138
15 D A -1.3570
16 Y A -0.8127
17 F A 0.0000
18 V A 0.4659
19 F A -0.0856
20 D A -0.8672
21 T A -1.5540
22 E A -2.2609
23 A A -1.2777
24 D A -1.0416
25 P A -0.6443
26 T A -0.7700
27 A A -0.6380
28 G A -0.7755
29 F A 0.0000
30 V A 0.0000
31 K A -1.5303
32 Y A 0.0000
33 V A 0.0000
34 D A -1.6632
35 Q A -1.2539
36 S A -1.3911
37 T A -1.6216
38 A A 0.0000
39 S A -1.5973
40 N A -2.3041
41 D A -2.5610
42 A A -1.3497
43 L A 0.0000
44 Y A 0.0000
45 S A -0.7591
46 T A -0.9348
47 S A -1.2809
48 N A -2.0553
49 N A -2.1724
50 Q A -1.4292
51 I A 0.0000
52 Y A -0.0254
53 L A 0.0000
54 G A -0.3953
55 V A 0.0000
56 D A -0.9616
57 K A -1.1434
58 T A -0.2636
59 T A 0.2945
60 V A 1.2518
61 L A 0.1010
62 D A -1.4986
63 S A -0.9501
64 S A -0.9541
65 S A -0.9631
66 T A -0.7412
67 G A 0.0000
68 R A 0.0000
69 N A -1.0066
70 S A 0.0000
71 V A 0.0000
72 R A 0.0000
73 V A 0.0000
74 Y A 0.3042
75 S A 0.0000
76 Q A -1.5558
77 N A -1.8140
78 T A -1.2658
79 F A 0.0000
80 S A -0.5618
81 S A -0.7971
82 A A 0.0000
83 I A 0.0000
84 L A 0.0000
85 I A 0.0000
86 T A 0.0000
87 D A -0.5556
88 F A 0.0000
89 A A -0.3866
90 H A -0.3419
91 L A 0.0000
92 P A 0.0000
93 V A -0.3608
94 S A -0.6399
95 V A -0.5090
96 C A 0.0000
97 G A 0.0000
98 I A 0.0000
99 W A -0.1901
100 P A 0.0000
101 A A 0.0000
102 Y A 0.0000
103 W A 0.1463
104 T A 0.0000
105 I A -0.3825
106 N A 0.0000
107 N A -2.0767
108 Q A -2.2240
109 A A -1.5131
110 N A -1.9384
111 P A -1.3192
112 Y A -0.6350
113 G A 0.0000
114 E A -0.0704
115 I A 0.0000
116 D A 0.0000
117 I A 0.0000
118 M A 0.0000
119 E A -0.2400
120 A A 0.0000
121 Y A -0.3237
122 D A 0.0000
123 D A -1.8330
124 V A -0.6527
125 A A -0.4145
126 G A 0.0000
127 A A 0.0000
128 Y A 0.0000
129 V A 0.0000
130 S A 0.0000
131 L A 0.0000
132 H A -0.3270
133 T A 0.0000
134 S A -0.5664
135 N A -1.1167
136 T A -0.6872
137 C A 0.0000
138 T A -1.0268
139 L A 0.0000
140 S A -1.6750
141 N A -2.0822
142 R A -2.6009
143 N A -2.2386
144 F A -1.2007
145 T A -0.6022
146 G A -0.9047
147 T A -1.0925
148 R A -2.0746
149 T A -1.6112
150 R A -1.4633
151 T A -1.2120
152 D A -1.4485
153 A A 0.0000
154 T A -0.4763
155 L A 0.1741
156 S A -0.2474
157 S A -0.6317
158 G A -0.8026
159 G A -0.8732
160 G A 0.0000
161 C A 0.0000
162 G A 0.0000
163 V A 0.0000
164 Q A -0.8845
165 S A 0.0000
166 T A -0.3427
167 S A -0.3995
168 S A -0.4804
169 Q A -0.4142
170 F A 0.0000
171 G A 0.0000
172 A A -0.3365
173 G A -0.4280
174 F A 0.0000
175 N A -0.4647
176 A A -0.2466
177 A A -0.6575
178 G A -0.7995
179 G A 0.0000
180 G A 0.0000
181 V A 0.0000
182 W A 0.0000
183 V A 0.0000
184 L A 0.0000
185 S A 0.0000
186 L A 0.0000
187 E A -1.5204
188 N A -2.1709
189 S A 0.0000
190 L A 0.0000
191 Q A -0.5566
192 L A 0.0000
193 W A 0.0000
194 V A 0.0000
195 F A 0.0000
196 P A -1.2189
197 R A -1.6512
198 N A -2.1082
199 Q A -1.8555
200 I A -0.9068
201 P A -0.7324
202 A A -0.6419
203 D A -0.9140
204 I A 0.0000
205 T A -0.8333
206 N A -1.6087
207 G A -0.8793
208 S A -0.5938
209 P A 0.0000
210 A A -0.2075
211 P A -0.3735
212 S A -0.4281
213 S A -0.5079
214 W A 0.0000
215 G A -0.5837
216 T A -0.6357
217 P A 0.0000
218 L A 0.0000
219 F A 0.0000
220 E A -1.0090
221 F A 0.0000
222 D A -2.1913
223 S A -2.2376
224 N A -2.4897
225 N A -2.3283
226 G A -1.6047
227 C A -1.4018
228 D A -2.0831
229 V A 0.0000
230 S A -1.0297
231 S A -0.8746
232 N A 0.0000
233 F A 0.0000
234 I A -0.5591
235 D A -1.5418
236 Q A 0.0000
237 T A 0.0000
238 V A 0.0000
239 I A 0.0000
240 F A 0.0000
241 N A -0.0428
242 L A 0.0000
243 D A 0.0000
244 F A 0.0000
245 C A 0.0000
246 G A -1.1998
247 Q A -2.0991
248 N A -2.2039
249 G A 0.0000
250 A A 0.0000
251 G A 0.0000
252 G A -1.7147
253 Q A -1.9081
254 E A 0.0000
255 W A 0.0000
256 S A -1.6598
257 D A -2.0560
258 W A -0.3701
259 T A -1.3635
260 D A -2.3075
261 C A 0.0000
262 A A -1.1238
263 T A -1.1746
264 T A -0.8206
265 T A -0.7343
266 G A -0.9269
267 Q A -0.7992
268 S A -0.6140
269 T A -0.5270
270 C A 0.0000
271 N A -0.7835
272 A A -0.6483
273 Y A -0.2818
274 V A 0.0000
275 A A 0.0000
276 A A 0.1037
277 N A -0.1026
278 P A -0.2307
279 S A -0.6652
280 A A -0.5677
281 Y A 0.0000
282 S A -0.9521
283 E A -1.2248
284 T A 0.0000
285 Y A -0.0307
286 F A 0.0000
287 S A 0.0000
288 I A 0.0000
289 N A -0.9309
290 S A -0.8318
291 I A 0.0000
292 K A -0.7723
293 L A 0.0000
294 Y A 0.0000
295 Q A -0.6764
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3486 2.8999 View CSV PDB
4.5 -0.3942 2.6268 View CSV PDB
5.0 -0.4466 2.3342 View CSV PDB
5.5 -0.5016 2.0346 View CSV PDB
6.0 -0.5552 1.7422 View CSV PDB
6.5 -0.6048 1.6493 View CSV PDB
7.0 -0.6498 1.5713 View CSV PDB
7.5 -0.6901 1.5181 View CSV PDB
8.0 -0.7245 1.4893 View CSV PDB
8.5 -0.7505 1.4767 View CSV PDB
9.0 -0.766 1.4721 View CSV PDB