Project name: ad0651dfed7572

Status: done

Started: 2026-03-24 07:46:07
Chain sequence(s) A: EVQLVESGGGLVKPGGSLKVSCAASGFSLSSYVLSWVRQTPEKRLEWVATINSLGAITYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARVSNFFFDVWGAGTTVTVSS
B: DIVMTQSHKFMSTSVGDRVSITCKASQDISNDVHWYQEKPGQCPKLLIYGASNRYSGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQSDFFPDTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:33)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ad0651dfed7572/tmp/folded.pdb                 (00:02:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:52)
Show buried residues

Minimal score value
-2.8152
Maximal score value
2.0976
Average score
-0.5506
Total score value
-123.3422

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9238
2 V A -0.8771
3 Q A -0.7818
4 L A 0.0000
5 V A 1.4791
6 E A 0.0000
7 S A -0.2847
8 G A -1.0044
9 G A -0.5044
10 G A 0.2037
11 L A 1.1107
12 V A -0.1838
13 K A -1.7291
14 P A -1.6230
15 G A -1.3472
16 G A -1.0513
17 S A -1.1211
18 L A -0.8225
19 K A -2.0674
20 V A 0.0000
21 S A -0.3576
22 C A 0.0000
23 A A 0.1220
24 A A -0.1463
25 S A -0.6073
26 G A -1.0271
27 F A -0.3748
28 S A -0.4622
29 L A 0.0000
30 S A -0.0443
31 S A 0.1599
32 Y A 0.6433
33 V A 1.0507
34 L A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -1.0905
40 T A -1.7052
41 P A -1.8097
42 E A -2.7473
43 K A -2.5522
44 R A -1.9936
45 L A 0.0000
46 E A -0.7753
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.7039
51 I A 0.0000
52 N A 1.1559
53 S A 0.9674
54 L A 1.6193
55 G A 0.7971
56 A A 1.1780
57 I A 2.0976
58 T A 1.2786
59 Y A 1.3239
60 Y A -0.1536
61 P A 0.0000
62 D A -2.3696
63 S A -1.7538
64 V A 0.0000
65 K A -2.4719
66 G A -1.7061
67 R A -1.3450
68 F A 0.0000
69 T A -0.7511
70 I A 0.0000
71 S A -0.3002
72 R A -0.7039
73 D A -1.2569
74 N A -1.3392
75 A A -1.3108
76 K A -2.1790
77 N A -1.5210
78 T A -0.8306
79 L A 0.0000
80 Y A -0.4983
81 L A 0.0000
82 Q A -1.4230
83 M A 0.0000
84 S A -1.0099
85 S A -1.0006
86 L A 0.0000
87 R A -2.1830
88 S A -1.9094
89 E A -2.3127
90 D A 0.0000
91 T A -0.6366
92 A A 0.0000
93 M A -0.0138
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 V A 0.7695
100 S A 0.2430
101 N A -0.1974
102 F A 1.2800
103 F A 0.0000
104 F A 0.0000
105 D A -0.1972
106 V A -0.1626
107 W A 0.0000
108 G A 0.0000
109 A A 0.0963
110 G A 0.1739
111 T A 0.0097
112 T A 0.0263
113 V A 0.0000
114 T A -0.0971
115 V A 0.0000
116 S A -0.8991
117 S A -0.7796
1 D B -1.0393
2 I B 0.0000
3 V B 0.7044
4 M B 0.0000
5 T B -0.6398
6 Q B -1.1600
7 S B -1.0416
8 H B -1.5190
9 K B -1.6851
10 F B 0.0974
11 M B -0.2280
12 S B -0.2719
13 T B 0.0000
14 S B -0.6627
15 V B -0.0913
16 G B -1.1958
17 D B -1.8895
18 R B -2.6060
19 V B -1.2564
20 S B -0.4992
21 I B 0.0000
22 T B -0.9016
23 C B 0.0000
24 K B -1.7447
25 A B -1.1778
26 S B -0.9894
27 Q B -1.8413
28 D B -2.8152
29 I B 0.0000
30 S B -1.7619
31 N B -1.8305
32 D B -0.7848
33 V B 0.0000
34 H B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 E B -1.3340
39 K B -1.8767
40 P B -1.1884
41 G B -1.3348
42 Q B -1.8710
43 C B -1.0334
44 P B 0.0000
45 K B -1.4423
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B -0.5317
50 G B -0.8552
51 A B 0.0000
52 S B -1.3175
53 N B -1.7300
54 R B -1.7132
55 Y B -0.6817
56 S B -0.7619
57 G B -0.8718
58 V B -0.8691
59 P B -1.2102
60 D B -2.2019
61 R B -1.8608
62 L B 0.0000
63 T B -1.0257
64 G B 0.0000
65 S B -0.9508
66 G B -1.2588
67 S B -1.6823
68 G B -2.0070
69 T B -2.1627
70 D B -2.4810
71 F B 0.0000
72 T B -0.7617
73 L B 0.0000
74 T B -0.5349
75 I B 0.0000
76 S B -1.9950
77 N B -2.2652
78 V B 0.0000
79 E B -1.7713
80 S B -1.3570
81 E B -1.9866
82 D B 0.0000
83 L B -0.9006
84 A B 0.0000
85 D B -0.9711
86 Y B 0.0000
87 F B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 S B 0.0000
92 D B 0.1699
93 F B 1.8831
94 F B 1.9127
95 P B 0.7828
96 D B 0.4344
97 T B 0.1575
98 F B 0.0000
99 G B 0.0000
100 G B -1.6257
101 G B 0.0000
102 T B 0.0000
103 K B -0.9896
104 L B 0.0000
105 E B -0.4152
106 I B -0.7402
107 K B -1.4454
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5343 6.0496 View CSV PDB
4.5 -0.5831 5.9155 View CSV PDB
5.0 -0.638 5.744 View CSV PDB
5.5 -0.6884 5.5515 View CSV PDB
6.0 -0.7234 5.3506 View CSV PDB
6.5 -0.7373 5.1469 View CSV PDB
7.0 -0.7326 4.943 View CSV PDB
7.5 -0.7159 4.7412 View CSV PDB
8.0 -0.6915 4.5463 View CSV PDB
8.5 -0.6595 4.3682 View CSV PDB
9.0 -0.6185 4.2218 View CSV PDB