Project name: ad3f6b728af7dd9

Status: done

Started: 2026-05-13 14:40:39
Chain sequence(s) A: VDAKFDKEAYRALAEIARLPNLTEEQRAGFIQSLKDDPSVSKAILAEAKKLNDAQAPKVDAKFDKEAYRALAEIARLPNLTEEQRAGFIQSLKDDPSVSKAILAEAKKLNDAQAPKVDAKFDKEAYRALAEIARLPNLTEEQRAGFIQSLKDDPSVSKAILAEAKKLNDAQAPKVDAKFDKEAYRALAEIARLPNLTEEQRAGFIQSLKDDPSVSKAILAEAKKLNDAQAPK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:51)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ad3f6b728af7dd9/tmp/folded.pdb                (00:05:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:54)
Show buried residues

Minimal score value
-3.3294
Maximal score value
1.2164
Average score
-1.4081
Total score value
-326.6691

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 V A 1.2164
2 D A -0.5115
3 A A -0.9246
4 K A -1.7860
5 F A -0.0178
6 D A -1.0510
7 K A -2.2548
8 E A -2.1785
9 A A 0.0000
10 Y A -0.4383
11 R A -2.0961
12 A A 0.0000
13 L A -0.7780
14 A A -0.9954
15 E A -1.6660
16 I A 0.0000
17 A A -1.4190
18 R A -2.1790
19 L A 0.0000
20 P A -1.2610
21 N A -1.4092
22 L A 0.0000
23 T A -1.8587
24 E A -2.9666
25 E A -2.9786
26 Q A -2.0557
27 R A -2.0079
28 A A -1.6643
29 G A -1.7548
30 F A 0.0000
31 I A -1.1250
32 Q A -2.2803
33 S A -1.8791
34 L A 0.0000
35 K A -2.9916
36 D A -3.2941
37 D A -2.4418
38 P A -1.3071
39 S A -0.7221
40 V A -0.3845
41 S A 0.0000
42 K A -2.0428
43 A A -0.9988
44 I A 0.0000
45 L A -1.4719
46 A A -1.7591
47 E A -2.8778
48 A A 0.0000
49 K A -2.6490
50 K A -3.1176
51 L A -1.8283
52 N A 0.0000
53 D A -3.0055
54 A A -1.6701
55 Q A -1.5604
56 A A -1.3057
57 P A -0.9618
58 K A -1.2606
59 V A 0.3673
60 D A -0.9585
61 A A -1.0564
62 K A -1.8956
63 F A -0.6736
64 D A -1.0554
65 K A -2.2570
66 E A -2.1459
67 A A 0.0000
68 Y A -0.4209
69 R A -2.0578
70 A A 0.0000
71 L A -0.7471
72 A A -0.9963
73 E A -1.7478
74 I A 0.0000
75 A A -1.4428
76 R A -2.2075
77 L A 0.0000
78 P A -1.1874
79 N A -1.4277
80 L A 0.0000
81 T A -1.8635
82 E A -2.9646
83 E A -2.9766
84 Q A -2.0590
85 R A -2.0024
86 A A -1.6585
87 G A -1.7518
88 F A 0.0000
89 I A -1.1170
90 Q A -2.2886
91 S A -1.8847
92 L A 0.0000
93 K A -2.9972
94 D A -3.3030
95 D A -2.4530
96 P A -1.3588
97 S A -0.6940
98 V A -0.4131
99 S A 0.0000
100 K A -1.9726
101 A A -0.9917
102 I A 0.0000
103 L A -1.4785
104 A A -1.7559
105 E A -2.8762
106 A A 0.0000
107 K A -2.6286
108 K A -3.1167
109 L A -1.8333
110 N A 0.0000
111 D A -3.0287
112 A A -1.7097
113 Q A -1.6102
114 A A -1.4083
115 P A -0.9793
116 K A -1.3599
117 V A 0.1736
118 D A -1.0304
119 A A -1.0901
120 K A -1.8007
121 F A -0.7812
122 D A -1.2911
123 K A -2.0627
124 E A -2.2080
125 A A 0.0000
126 Y A -0.6233
127 R A -2.1116
128 A A 0.0000
129 L A -0.7633
130 A A -1.0734
131 E A -1.8996
132 I A 0.0000
133 A A -1.4707
134 R A -2.2578
135 L A 0.0000
136 P A -1.3709
137 N A -1.4457
138 L A 0.0000
139 T A -1.8645
140 E A -2.9667
141 E A -2.9444
142 Q A -2.0108
143 R A -1.9373
144 A A -1.5979
145 G A -1.6525
146 F A -1.3258
147 I A -1.0487
148 Q A -2.2352
149 S A -1.8230
150 L A 0.0000
151 K A -2.9759
152 D A -3.2792
153 D A -2.4325
154 P A -1.3805
155 S A -0.9199
156 V A -0.4125
157 S A 0.0000
158 K A -1.9770
159 A A -0.9788
160 I A 0.0000
161 L A -1.4783
162 A A -1.8158
163 E A -2.8541
164 A A 0.0000
165 K A -2.6613
166 K A -3.1473
167 L A -1.9259
168 N A 0.0000
169 D A -3.0491
170 A A -1.7361
171 Q A -1.6298
172 A A -1.3498
173 P A -0.9968
174 K A -1.3453
175 V A 0.1932
176 D A -1.2361
177 A A -1.3059
178 K A -2.1798
179 F A -1.1868
180 D A -1.5637
181 K A -2.5738
182 E A -2.3768
183 A A 0.0000
184 Y A -0.5923
185 R A -2.1743
186 A A 0.0000
187 L A -0.8003
188 A A -1.0322
189 E A -1.7891
190 I A 0.0000
191 A A -1.4450
192 R A -2.2275
193 L A 0.0000
194 P A -1.4491
195 N A -1.4498
196 L A 0.0000
197 T A -1.8558
198 E A -2.9812
199 E A -2.9457
200 Q A -2.0365
201 R A -1.9753
202 A A -1.6243
203 G A -1.6878
204 F A 0.0000
205 I A -1.0104
206 Q A -2.3376
207 S A -1.8734
208 L A 0.0000
209 K A -3.0278
210 D A -3.3294
211 D A -2.4869
212 P A -1.5263
213 S A -1.0500
214 V A -0.4905
215 S A 0.0000
216 K A -1.9006
217 A A -0.8796
218 I A -0.9041
219 L A -1.3182
220 A A -1.7021
221 E A -2.7531
222 A A 0.0000
223 K A -2.6265
224 K A -3.1129
225 L A -1.9230
226 N A 0.0000
227 D A -2.8611
228 A A -1.6905
229 Q A -1.5824
230 A A -1.4075
231 P A -1.4378
232 K A -1.8647
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.1643 1.9573 View CSV PDB
4.5 -1.3041 1.8014 View CSV PDB
5.0 -1.4708 1.6404 View CSV PDB
5.5 -1.6327 1.486 View CSV PDB
6.0 -1.7528 1.3488 View CSV PDB
6.5 -1.8013 1.2319 View CSV PDB
7.0 -1.7789 1.1308 View CSV PDB
7.5 -1.7101 1.1457 View CSV PDB
8.0 -1.6159 1.357 View CSV PDB
8.5 -1.5026 1.6068 View CSV PDB
9.0 -1.3692 1.8899 View CSV PDB