Project name: fold_rfa148_b3v_a5v_b39s_fv84b_b27vq_b93vc_a11ls

Status: done

Started: 2026-06-25 02:42:28
Chain sequence(s) A: EVQLAESGGGSEQPGGSLRLSCAGSGFTFSSQGFGWVRQAPGKGLEWVSSISADGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLSRVRVGSTRGVVGDVWGQGTTVTVSS
B: DIAMTQSPLSLPVTPGEPASISCRSSQETSAIGWYLQKPGQSPQLLIYGTSTRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTGCPGTFGQGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ad535c167d4c243/tmp/folded.pdb                (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:09)
Show buried residues

Minimal score value
-3.5559
Maximal score value
0.5932
Average score
-0.9259
Total score value
-214.8093

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.0974
2 V A -1.1928
3 Q A -1.7286
4 L A 0.0000
5 A A -0.6327
6 E A 0.0000
7 S A -0.8490
8 G A -1.1114
9 G A -0.8656
10 G A -0.7847
11 S A -0.9065
12 E A -1.6066
13 Q A -2.0689
14 P A -1.9977
15 G A -1.5866
16 G A -1.4404
17 S A -1.6586
18 L A -1.4738
19 R A -2.3665
20 L A 0.0000
21 S A -0.7173
22 C A 0.0000
23 A A -0.7301
24 G A 0.0000
25 S A -1.0857
26 G A -1.2132
27 F A -0.5332
28 T A -0.3167
29 F A 0.0000
30 S A -1.3244
31 S A -0.8124
32 Q A -0.9999
33 G A -0.9397
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8400
40 A A -1.2218
41 P A -0.9749
42 G A -1.4486
43 K A -2.4075
44 G A -1.6207
45 L A 0.0000
46 E A -1.2285
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A -0.0493
51 I A 0.0000
52 S A -0.9741
53 A A -1.3415
54 D A -2.2763
55 G A -1.4918
56 S A -1.0053
57 G A -0.7631
58 T A -0.1850
59 Y A -0.1383
60 Y A -0.7535
61 A A 0.0000
62 D A -2.4650
63 S A -1.7050
64 V A 0.0000
65 K A -2.5890
66 G A -1.8431
67 R A -1.8832
68 F A 0.0000
69 T A -1.0507
70 I A 0.0000
71 S A -0.5163
72 R A -1.2797
73 D A -1.7950
74 N A -2.0923
75 S A -1.6548
76 K A -2.4175
77 N A -1.8099
78 T A -1.2325
79 L A 0.0000
80 Y A -0.6943
81 L A 0.0000
82 Q A -1.7432
83 M A 0.0000
84 N A -2.1548
85 S A -1.4905
86 L A 0.0000
87 R A -2.3926
88 A A -1.7892
89 E A -2.2125
90 D A 0.0000
91 T A -0.9068
92 A A 0.0000
93 V A 0.1803
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.4732
99 L A -0.5228
100 S A -0.9673
101 R A -2.5599
102 V A 0.0000
103 R A -2.7584
104 V A -0.9828
105 G A -1.0726
106 S A -1.1081
107 T A -1.7330
108 R A -2.8863
109 G A 0.0000
110 V A -1.0972
111 V A 0.0000
112 G A 0.0000
113 D A -0.7960
114 V A -0.4479
115 W A 0.0000
116 G A 0.0000
117 Q A -1.6393
118 G A -0.7578
119 T A -0.3878
120 T A -0.1171
121 V A 0.0000
122 T A -0.8604
123 V A 0.0000
124 S A -1.2960
125 S A -0.9838
1 D B -1.7400
2 I B -1.1531
3 A B -1.0086
4 M B 0.0000
5 T B -1.0069
6 Q B 0.0000
7 S B -0.3019
8 P B 0.0510
9 L B 0.5932
10 S B -0.1815
11 L B -0.4473
12 P B -1.4306
13 V B 0.0000
14 T B -2.1249
15 P B -2.3486
16 G B -2.1777
17 E B -2.9135
18 P B -2.5072
19 A B 0.0000
20 S B -0.9202
21 I B 0.0000
22 S B -1.0528
23 C B 0.0000
24 R B -2.9131
25 S B 0.0000
26 S B -1.9127
27 Q B -2.7558
28 E B -2.9367
29 T B 0.0000
30 S B -1.3190
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -1.1684
38 K B -1.8118
39 P B -1.1018
40 G B -1.5109
41 Q B -2.2025
42 S B -1.5041
43 P B 0.0000
44 Q B -1.3890
45 L B -0.6447
46 L B 0.0000
47 I B 0.0000
48 Y B -0.2071
49 G B 0.0000
50 T B 0.0000
51 S B -0.5146
52 T B -0.6156
53 R B -1.5142
54 G B -0.9018
55 S B -0.7509
56 G B -0.9068
57 V B -1.0885
58 P B -1.3615
59 D B -2.4691
60 R B -2.2961
61 F B 0.0000
62 S B -1.5935
63 G B -0.9548
64 S B -1.0067
65 G B -1.2318
66 S B -1.3870
67 G B -1.9013
68 T B -2.4723
69 D B -2.7262
70 F B 0.0000
71 T B -1.3037
72 L B 0.0000
73 K B -2.2304
74 I B 0.0000
75 S B -2.6001
76 R B -3.5559
77 V B 0.0000
78 E B -2.6518
79 A B -1.4939
80 E B -2.1897
81 D B 0.0000
82 V B -1.0282
83 G B 0.0000
84 V B -0.4659
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B -0.3909
91 T B -1.0665
92 G B -0.4779
93 C B 0.3522
94 P B -0.3206
95 G B -0.1879
96 T B -0.4589
97 F B -0.3265
98 G B 0.0000
99 Q B -1.4421
100 G B 0.0000
101 T B 0.0000
102 K B -1.0629
103 L B 0.0000
104 E B -1.8381
105 I B -1.9443
106 K B -2.8392
107 R B -2.7993
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.9219 2.1016 View CSV PDB
4.5 -0.97 2.0358 View CSV PDB
5.0 -1.029 1.9579 View CSV PDB
5.5 -1.0896 1.875 View CSV PDB
6.0 -1.1419 1.7905 View CSV PDB
6.5 -1.1771 1.7056 View CSV PDB
7.0 -1.1923 1.6207 View CSV PDB
7.5 -1.1921 1.5367 View CSV PDB
8.0 -1.1826 1.4554 View CSV PDB
8.5 -1.1656 1.4679 View CSV PDB
9.0 -1.1413 1.6047 View CSV PDB