Project name: ValAla_R3

Status: done

Started: 2026-08-20 09:17:23
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:52)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ae5c59f95efd7eb/tmp/folded.pdb                (00:01:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:14)
Show buried residues

Minimal score value
-2.6811
Maximal score value
1.928
Average score
-0.5424
Total score value
-134.5041

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6953
2 V A 0.0000
3 Q A -2.0710
4 L A 0.0000
5 Q A -1.8499
6 E A 0.0000
7 S A -0.6843
8 G A -0.3729
9 P A 0.0472
10 G A 0.3997
11 L A 0.9781
12 V A 0.0000
13 K A -1.8411
14 P A -1.3502
15 S A -1.4523
16 Q A -2.0281
17 T A -1.6866
18 L A 0.0000
19 S A -1.0262
20 L A 0.0000
21 T A -0.6299
22 V A 0.0000
23 T A -1.2336
24 V A 0.0000
25 S A -1.3927
26 G A -1.4234
27 G A -1.0894
28 S A -0.7251
29 I A 0.0000
30 S A -0.2600
31 S A -0.3452
32 G A -0.1493
33 D A -0.0829
34 Y A 0.5476
35 Y A 0.5498
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.3899
41 Q A 0.0000
42 P A -0.7124
43 P A -0.6740
44 G A -1.1177
45 C A -1.2496
46 K A -2.0512
47 G A -1.2775
48 L A 0.0000
49 E A -0.7595
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1486
54 I A 0.0000
55 Y A 0.3086
56 Y A 0.3189
57 S A -0.0907
58 G A -0.2380
59 S A -0.2585
60 T A -0.2486
61 D A -0.7066
62 Y A -0.7128
63 N A -0.9660
64 P A -1.2825
65 S A -1.1053
66 L A 0.0000
67 K A -2.1261
68 S A -1.4653
69 R A -1.7720
70 V A 0.0000
71 T A -1.1633
72 M A 0.0000
73 S A -0.3891
74 V A -0.3536
75 D A -1.1798
76 T A -1.0338
77 S A -1.3245
78 K A -2.1654
79 N A -1.4370
80 Q A -1.2534
81 F A 0.0000
82 S A -0.5584
83 L A 0.0000
84 K A -1.6805
85 V A 0.0000
86 N A -1.8779
87 S A -1.5947
88 V A 0.0000
89 T A -0.6958
90 A A -0.2530
91 A A -0.0277
92 D A 0.0000
93 T A 0.2830
94 A A 0.0000
95 V A 0.2093
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.6743
103 I A 1.4098
104 F A 1.9280
105 G A 0.7569
106 V A 0.7412
107 G A 0.6558
108 T A 0.0000
109 F A 0.0000
110 D A -0.6412
111 Y A -0.6505
112 W A -0.8492
113 G A 0.0000
114 Q A -1.6281
115 G A -0.7573
116 T A -0.1682
117 L A 0.8975
118 V A 0.0000
119 T A 0.3711
120 V A 0.0000
121 S A -0.3743
122 S A -0.6324
123 A A -0.6181
124 A A -0.3549
125 G A -0.8383
126 G A -1.0822
127 G A -1.1258
128 G A -1.1921
129 S A -1.0269
130 G A -1.1778
131 G A -1.2039
132 G A -1.1742
133 G A -1.2286
134 S A -1.0451
135 G A -1.2104
136 G A -1.3910
137 G A -1.2785
138 G A -1.2952
139 S A -1.1115
140 D A -1.2160
141 I A -0.2580
142 V A 0.8889
143 M A 0.0000
144 T A -0.5595
145 Q A -0.6570
146 S A -0.7459
147 P A -0.3518
148 A A -0.3767
149 T A -0.4921
150 L A -0.2179
151 S A -0.3503
152 L A -0.6668
153 S A -0.9534
154 P A -1.4215
155 G A -1.7874
156 E A -2.4116
157 R A -2.6811
158 A A 0.0000
159 T A -0.6555
160 L A 0.0000
161 S A -0.8384
162 V A 0.0000
163 R A -2.2899
164 A A 0.0000
165 S A -0.9135
166 Q A -1.6076
167 S A -1.1885
168 V A 0.0000
169 S A -0.3914
170 S A -0.0889
171 Y A 0.8706
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4791
179 P A -0.9024
180 G A -0.9891
181 C A -1.1459
182 Q A -1.5923
183 A A -1.1941
184 P A 0.0000
185 R A -1.4959
186 L A -0.7090
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2919
190 D A -0.3793
191 A A 0.0000
192 S A -0.9290
193 N A -1.3775
194 R A -1.5449
195 A A -1.0221
196 T A -0.6220
197 G A -0.6700
198 I A 0.0000
199 P A -0.4424
200 A A -0.3762
201 R A -0.6702
202 F A 0.0000
203 S A -0.6858
204 G A 0.0000
205 S A -0.7367
206 G A -1.0671
207 S A -0.8823
208 G A -1.0084
209 T A -1.6987
210 D A -2.0392
211 F A 0.0000
212 T A -0.7226
213 L A 0.0000
214 T A -0.5738
215 I A 0.0000
216 S A -1.3343
217 S A -1.7073
218 L A 0.0000
219 E A -2.0071
220 P A -1.2572
221 E A -1.9620
222 D A 0.0000
223 F A -0.6057
224 A A 0.0000
225 V A -0.6817
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3347
232 G A 0.0475
233 S A -0.2222
234 T A -0.4367
235 P A -0.4975
236 L A 0.0000
237 T A 0.1130
238 F A 0.2674
239 G A 0.0000
240 G A -0.8267
241 G A -0.8141
242 T A 0.0000
243 K A -0.9251
244 A A 0.0000
245 E A -0.4446
246 I A 0.7101
247 K A -0.8835
248 A A -0.3502
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5047 4.8652 View CSV PDB
4.5 -0.525 4.8617 View CSV PDB
5.0 -0.5481 4.8523 View CSV PDB
5.5 -0.5685 4.8309 View CSV PDB
6.0 -0.5802 4.7951 View CSV PDB
6.5 -0.5788 4.749 View CSV PDB
7.0 -0.5649 4.6983 View CSV PDB
7.5 -0.5428 4.6458 View CSV PDB
8.0 -0.5162 4.5929 View CSV PDB
8.5 -0.4862 4.5398 View CSV PDB
9.0 -0.4533 4.487 View CSV PDB