Project name: 661bcade0a6e7f5 [mutate: VT116A, LA176A]

Status: done

Started: 2026-05-22 03:50:37
Chain sequence(s) A: MYSTDVVKENAYLSATRSGLESNEIATLQRSLPSRFNLRHLKKNESLKLVLQKKAGKSRVVAYKFTSGSFNYTAYRISDKKFYNLSDTSGKGSLDYPLPATARLSSPFNPARLNPVSGKVSPHNGIDYSMPMNTKIVSVIDGKITRAEYNSTMGYFVEVTGKAGVKTRYLHLNKILVTKGARVTRGDAIALSGNSGRSSGPHLHYELVINNNPVNSLAFRAAAPADNKLEQHAFAHARDYERYLD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues LA176A,VT116A
Energy difference between WT (input) and mutated protein (by FoldX) 2.04105 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:11)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:11)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:11)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:11)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:12)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:12)
[INFO]       FoldX:    Building mutant model                                                       (00:02:34)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aeb8d0175b888fc/tmp/folded.pdb                (00:02:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:26)
Show buried residues

Minimal score value
-3.9505
Maximal score value
0.6172
Average score
-0.9176
Total score value
-224.8014

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.6172
2 Y A 0.3766
3 S A 0.1615
4 T A 0.0357
5 D A 0.1658
6 V A 0.4770
7 V A 0.0000
8 K A -3.2358
9 E A -3.6646
10 N A -2.1525
11 A A 0.0000
12 Y A -0.5611
13 L A 0.3813
14 S A 0.0000
15 A A 0.0000
16 T A -0.6681
17 R A -1.6424
18 S A -1.2221
19 G A -1.5717
20 L A 0.0000
21 E A -1.8473
22 S A -1.2105
23 N A -1.8707
24 E A 0.0000
25 I A 0.0000
26 A A -1.3567
27 T A 0.0000
28 L A 0.0000
29 Q A -1.8625
30 R A -2.4669
31 S A -1.3619
32 L A 0.0000
33 P A -1.2637
34 S A -1.7060
35 R A -2.2221
36 F A 0.0000
37 N A -2.9534
38 L A 0.0000
39 R A -2.6761
40 H A -3.3798
41 L A -3.4546
42 K A -3.9042
43 K A -3.9505
44 N A -3.2571
45 E A 0.0000
46 S A -1.9224
47 L A 0.0000
48 K A -0.4055
49 L A 0.0000
50 V A 0.0000
51 L A 0.0000
52 Q A -0.6771
53 K A -1.5712
54 K A -2.2633
55 A A -1.4584
56 G A -1.6681
57 K A -2.3532
58 S A 0.0000
59 R A -1.3335
60 V A 0.0000
61 V A 0.0000
62 A A 0.0000
63 Y A 0.0000
64 K A -0.6390
65 F A 0.0000
66 T A -0.7327
67 S A -1.0864
68 G A -1.0639
69 S A -0.4510
70 F A 0.0743
71 N A -0.4677
72 Y A -0.1917
73 T A -0.2960
74 A A 0.0000
75 Y A 0.0000
76 R A 0.0000
77 I A 0.0000
78 S A -1.8658
79 D A -2.9489
80 K A -3.1343
81 K A -1.8577
82 F A -0.6658
83 Y A 0.3276
84 N A -0.0217
85 L A 0.1570
86 S A -0.5489
87 D A -1.6014
88 T A -1.1044
89 S A -1.3290
90 G A -1.5979
91 K A -2.5105
92 G A -1.4068
93 S A -0.9906
94 L A 0.0000
95 D A 0.0000
96 Y A 0.0000
97 P A 0.0874
98 L A 0.5971
99 P A -0.1370
100 A A -0.0669
101 T A -0.3468
102 A A 0.0000
103 R A -1.4657
104 L A -0.2767
105 S A -0.5531
106 S A -0.4211
107 P A -0.4223
108 F A -0.6933
109 N A -1.1595
110 P A -0.8252
111 A A -0.5864
112 R A -0.9672
113 L A -0.0254
114 N A -0.8053
115 P A -0.6840
116 T A -0.6578 mutated: VT116A
117 S A -0.9505
118 G A -1.2459
119 K A -1.6304
120 V A -0.3581
121 S A -0.6358
122 P A -0.8104
123 H A 0.0000
124 N A -1.1477
125 G A 0.0000
126 I A 0.0000
127 D A -0.5344
128 Y A 0.0000
129 S A -0.6844
130 M A 0.0000
131 P A -0.7481
132 M A -1.0754
133 N A -1.9749
134 T A -1.3343
135 K A -2.0975
136 I A 0.0000
137 V A -0.6593
138 S A 0.0000
139 V A 0.0000
140 I A 0.0000
141 D A -2.6505
142 G A 0.0000
143 K A -2.8397
144 I A 0.0000
145 T A -1.9525
146 R A -2.2475
147 A A -1.5113
148 E A -1.6309
149 Y A 0.2863
150 N A -0.6013
151 S A -0.6091
152 T A -0.8125
153 M A -0.5425
154 G A 0.0000
155 Y A 0.1564
156 F A 0.0000
157 V A 0.0000
158 E A 0.0000
159 V A 0.0000
160 T A -1.5359
161 G A -1.8815
162 K A -2.1607
163 A A -1.1308
164 G A -1.5082
165 V A 0.0000
166 K A -1.4775
167 T A 0.0000
168 R A -0.5877
169 Y A 0.0000
170 L A 0.0000
171 H A 0.0000
172 L A 0.0000
173 N A -1.2131
174 K A -1.6122
175 I A -0.1455
176 A A -0.0635 mutated: LA176A
177 V A -0.4529
178 T A -1.4585
179 K A -2.8378
180 G A -1.9025
181 A A -1.8843
182 R A -2.8670
183 V A 0.0000
184 T A -1.7116
185 R A -1.5919
186 G A -1.4253
187 D A -1.7556
188 A A -0.7055
189 I A 0.0000
190 A A 0.0000
191 L A -1.1518
192 S A 0.0000
193 G A 0.0000
194 N A -1.6701
195 S A -1.1561
196 G A -1.2168
197 R A -2.3116
198 S A -1.5224
199 S A -1.0011
200 G A -0.9211
201 P A -0.9365
202 H A -0.9314
203 L A 0.0000
204 H A -0.4919
205 Y A 0.0000
206 E A 0.0000
207 L A 0.0000
208 V A 0.0000
209 I A 0.0000
210 N A -2.0107
211 N A -2.3923
212 N A -2.2575
213 P A -1.2887
214 V A -0.9179
215 N A -0.4995
216 S A 0.0000
217 L A -0.0242
218 A A -0.4076
219 F A -0.0770
220 R A -0.8421
221 A A -0.4935
222 A A -0.2249
223 A A -0.2284
224 P A -0.6816
225 A A -1.1781
226 D A -2.7372
227 N A -3.0193
228 K A -2.7317
229 L A -1.2751
230 E A -2.2338
231 Q A -2.5614
232 H A -2.2005
233 A A 0.0000
234 F A -1.1609
235 A A 0.0000
236 H A -1.5263
237 A A -0.8813
238 R A -1.5289
239 D A -1.5337
240 Y A 0.0000
241 E A -2.7009
242 R A -2.9273
243 Y A -1.3499
244 L A 0.0000
245 D A -2.5844
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.063 2.1304 View CSV PDB
4.5 -1.0983 2.1304 View CSV PDB
5.0 -1.1379 2.1304 View CSV PDB
5.5 -1.1704 2.1304 View CSV PDB
6.0 -1.1829 2.1304 View CSV PDB
6.5 -1.1663 2.1304 View CSV PDB
7.0 -1.1234 2.1304 View CSV PDB
7.5 -1.0656 2.1304 View CSV PDB
8.0 -1.001 2.1304 View CSV PDB
8.5 -0.9318 2.1304 View CSV PDB
9.0 -0.8573 2.1304 View CSV PDB