Project name: aeb9050be39d715

Status: done

Started: 2026-07-06 09:44:04
Chain sequence(s) A: EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:32)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/aeb9050be39d715/tmp/folded.pdb                (00:01:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:04)
Show buried residues

Minimal score value
-3.896
Maximal score value
0.3725
Average score
-1.7027
Total score value
-183.8966

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
278 E A -3.8960
279 Q A -3.3802
280 D A -3.8008
281 N A -3.8046
282 S A -2.7675
283 D A -3.1612
284 N A -2.8458
285 N A -2.0348
286 T A -1.3303
287 I A 0.0000
288 F A -0.4695
289 V A 0.0000
290 Q A -1.7172
291 G A -2.1941
292 L A 0.0000
293 G A -2.3111
294 E A -2.9466
295 N A -2.3304
296 V A 0.0000
297 T A -1.1323
298 I A -1.0440
299 E A -2.1791
300 S A -1.3385
301 V A 0.0000
302 A A 0.0000
303 D A -1.8703
304 Y A -0.6322
305 F A 0.0000
306 K A -1.7890
307 Q A -1.4056
308 I A -0.1509
309 G A -0.3453
310 I A 0.3725
311 I A 0.0000
312 K A -1.7000
313 T A -1.8129
314 N A -2.5022
315 K A -3.1904
316 K A -3.0143
317 T A -2.1057
318 G A -2.4270
319 Q A -2.5094
320 P A -1.7514
321 M A -1.3041
322 I A 0.0000
323 N A -0.9430
324 L A -0.3907
325 Y A -0.7847
326 T A -2.1604
327 D A -3.1953
328 R A -3.5429
329 E A -3.3603
330 T A -2.2791
331 G A -2.7077
332 K A -3.0612
333 L A -2.4642
334 K A -2.6723
335 G A -2.1440
336 E A -1.7617
337 A A 0.0000
338 T A 0.0000
339 V A 0.0000
340 S A 0.0000
341 F A 0.0000
342 D A -1.9589
343 D A -1.8212
344 P A -1.9125
345 P A -1.6917
346 S A -1.1651
347 A A 0.0000
348 K A -2.4521
349 A A -1.2684
350 A A 0.0000
351 I A -1.8201
352 D A -2.2860
353 W A -1.0244
354 F A 0.0000
355 D A -3.3476
356 G A -2.9662
357 K A -2.8479
358 E A -3.3511
359 F A 0.0000
360 S A -1.3478
361 G A -1.7326
362 N A -2.2869
363 P A -2.6393
364 I A 0.0000
365 K A -2.9174
366 V A 0.0000
367 S A -1.1050
368 F A -0.8293
369 A A -1.1599
370 T A -1.2813
371 R A -3.1390
372 R A -3.0128
373 A A -1.9481
374 D A -1.9894
375 F A -0.4185
376 N A -2.3024
377 R A -3.1613
378 G A -2.4408
379 G A -1.8015
380 G A -1.8025
381 N A -3.0212
382 G A -3.1209
383 R A -3.1780
384 G A -1.8714
385 G A -1.1864
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.0725 2.5208 View CSV PDB
4.5 -1.1956 2.3368 View CSV PDB
5.0 -1.3433 2.134 View CSV PDB
5.5 -1.4938 1.9244 View CSV PDB
6.0 -1.6234 1.7127 View CSV PDB
6.5 -1.7107 1.5007 View CSV PDB
7.0 -1.7516 1.2899 View CSV PDB
7.5 -1.7601 1.0832 View CSV PDB
8.0 -1.7494 0.8888 View CSV PDB
8.5 -1.7214 0.9542 View CSV PDB
9.0 -1.6704 1.0611 View CSV PDB