Project name: af63640e7490b0

Status: done

Started: 2026-03-28 14:57:39
Chain sequence(s) A: NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
B: NFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/af63640e7490b0/tmp/folded.pdb                 (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:29)
Show buried residues

Minimal score value
-2.6617
Maximal score value
2.3457
Average score
-0.5655
Total score value
-125.5326

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 N A -1.3662
2 F A 0.0000
3 M A 0.5165
4 L A 0.0000
5 T A 0.1043
6 Q A 0.0000
7 P A -0.4121
8 H A -0.6157
9 S A -0.2736
10 V A 0.0112
11 S A 0.0394
12 E A -0.6708
13 S A -0.5243
14 P A -1.2570
15 G A -1.7597
16 K A -2.2323
17 T A -1.3000
18 V A 0.0000
19 T A -0.1414
20 I A 0.0000
21 S A -0.2373
22 C A 0.0000
23 T A -0.3157
24 G A -0.2171
25 S A -0.3617
26 S A -0.6403
27 G A -0.8193
28 S A -0.6221
29 I A 0.0000
30 A A -0.2106
31 S A -0.2170
32 N A -0.1796
33 Y A 0.6793
34 V A 0.0000
35 Q A -0.2349
36 W A 0.0000
37 Y A 0.0880
38 Q A 0.0000
39 Q A -1.1327
40 R A -1.7438
41 P A -1.0687
42 G A -0.9558
43 S A -0.8891
44 S A -0.6892
45 P A -0.6202
46 T A -0.2820
47 T A -0.1624
48 V A 0.0000
49 I A 0.0000
50 Y A -0.7925
51 E A -1.2792
52 D A -1.1738
53 N A -2.0396
54 Q A -2.0466
55 R A -1.9342
56 P A -0.7974
57 S A -0.8577
58 G A -0.8364
59 V A -0.9104
60 P A -1.3319
61 D A -2.2208
62 R A -1.5043
63 F A 0.0000
64 S A -1.3273
65 G A -1.1113
66 S A -0.9636
67 I A -0.4650
68 D A -1.3978
69 S A -1.0661
70 S A -0.8548
71 S A -0.8959
72 N A -0.9530
73 S A -0.7250
74 A A 0.0000
75 S A -0.4635
76 L A 0.0000
77 T A -0.2431
78 I A 0.0000
79 S A -1.3089
80 G A -1.4834
81 L A 0.0000
82 K A -2.2871
83 T A -1.6402
84 E A -2.6617
85 D A 0.0000
86 E A -1.9837
87 A A 0.0000
88 D A -0.9498
89 Y A 0.0000
90 Y A 0.2359
91 C A 0.0000
92 Q A 0.0000
93 S A 0.0000
94 Y A 0.4260
95 D A -0.9231
96 S A -1.1235
97 S A -1.1771
98 N A -1.4758
99 H A -0.9142
100 V A 1.3708
101 V A 0.0000
102 F A 1.9160
103 G A 0.0000
104 G A -0.1861
105 G A 0.0000
106 T A 0.0000
107 K A -0.8019
108 L A 0.0000
109 T A -0.1651
110 V A 0.0000
111 L A 1.3122
1 N B -1.3790
2 F B 0.0000
3 M B 0.7621
4 L B 0.0000
5 T B 0.1177
6 Q B -0.1698
7 P B -0.5245
8 H B -0.6753
9 S B -0.3143
10 V B -0.0910
11 S B -0.0360
12 E B -0.7480
13 S B -0.5580
14 P B -1.2207
15 G B -1.7364
16 K B -2.1879
17 T B -1.3233
18 V B 0.0000
19 T B -0.1039
20 I B 0.0000
21 S B -0.2661
22 C B 0.0000
23 T B -0.3808
24 G B 0.0000
25 S B -0.5185
26 S B -0.7092
27 G B -0.8486
28 S B -0.7574
29 I B 0.0000
30 A B -0.2099
31 S B -0.2789
32 N B -0.2553
33 Y B 0.6960
34 V B 0.0000
35 Q B 0.0153
36 W B 0.0000
37 Y B 0.1064
38 Q B 0.0000
39 Q B -1.2840
40 R B -2.1739
41 P B -1.3958
42 G B -1.0785
43 S B -1.0625
44 S B -0.8162
45 P B -0.7129
46 T B -0.3355
47 T B -0.0315
48 V B 0.0000
49 I B 0.0000
50 Y B -0.6668
51 E B -1.1418
52 D B -1.1227
53 N B -2.0572
54 Q B -2.1327
55 R B -2.3168
56 P B -1.1613
57 S B -0.9604
58 G B -0.9408
59 V B -1.0401
60 P B -1.3910
61 D B -2.3347
62 R B -1.6306
63 F B 0.0000
64 S B -1.4810
65 G B -1.1917
66 S B -0.8948
67 I B -0.3662
68 D B -1.1844
69 S B -0.9746
70 S B -0.8023
71 S B -0.8189
72 N B -0.9371
73 S B -0.6735
74 A B 0.0000
75 S B -0.4472
76 L B 0.0000
77 T B -0.2969
78 I B 0.0000
79 S B -1.3175
80 G B -1.3974
81 L B 0.0000
82 K B -2.1367
83 T B -1.4457
84 E B -2.5444
85 D B 0.0000
86 E B -1.6620
87 A B 0.0000
88 D B -0.8891
89 Y B 0.0000
90 Y B 0.4790
91 C B 0.0000
92 Q B 0.0000
93 S B 0.0000
94 Y B 0.5474
95 D B -0.6463
96 S B -1.2356
97 S B -1.1522
98 N B -1.4898
99 H B -0.7097
100 V B 1.5668
101 V B 0.0000
102 F B 2.3457
103 G B 0.0000
104 G B -0.1918
105 G B 0.0000
106 T B 0.0000
107 K B -0.7465
108 L B 0.0000
109 T B 0.0901
110 V B -0.2189
111 L B 1.3994
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5278 4.565 View CSV PDB
4.5 -0.569 4.5614 View CSV PDB
5.0 -0.6171 4.5604 View CSV PDB
5.5 -0.6653 4.5656 View CSV PDB
6.0 -0.7055 4.5809 View CSV PDB
6.5 -0.7323 4.6027 View CSV PDB
7.0 -0.7466 4.6203 View CSV PDB
7.5 -0.7525 4.6281 View CSV PDB
8.0 -0.752 4.6294 View CSV PDB
8.5 -0.7448 4.6287 View CSV PDB
9.0 -0.7312 4.6279 View CSV PDB