Project name: GC253_11F8 [mutate: CA22A, CA98A, CA162A, CA228A] [mutate: AV22A, AV162A]

Status: done

Started: 2026-08-20 08:35:33
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues AV22A,AV162A
Energy difference between WT (input) and mutated protein (by FoldX) 3.48457 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:36)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:41)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/afb31224c16acca/tmp/folded.pdb                (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:43)
Show buried residues

Minimal score value
-2.6843
Maximal score value
1.9063
Average score
-0.5795
Total score value
-143.7129

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6962
2 V A 0.0000
3 Q A -2.0563
4 L A 0.0000
5 Q A -1.8648
6 E A 0.0000
7 S A -0.7218
8 G A -0.4377
9 P A -0.0146
10 G A 0.3233
11 L A 0.8558
12 V A 0.0000
13 K A -1.8454
14 P A -1.3756
15 S A -1.4728
16 Q A -2.0269
17 T A -1.8078
18 L A 0.0000
19 S A -1.0977
20 L A 0.0000
21 T A -0.6559
22 V A 0.0000 mutated: AV22A
23 T A -1.2467
24 V A 0.0000
25 S A -1.3844
26 G A -1.4187
27 G A -1.1024
28 S A -0.6918
29 I A 0.0000
30 S A -0.3789
31 S A -0.3853
32 G A -0.2067
33 D A -0.2602
34 Y A 0.4275
35 Y A 0.4319
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.2386
41 Q A 0.0000
42 P A -0.7354
43 P A -0.6775
44 G A -1.1339
45 C A -1.2808
46 K A -2.0324
47 G A -1.2493
48 L A 0.0000
49 E A -0.8317
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.0815
54 I A 0.0000
55 Y A 0.1531
56 Y A 0.0647
57 S A -0.2232
58 G A -0.3171
59 S A -0.3023
60 T A -0.2983
61 D A -0.7491
62 Y A -0.8316
63 N A -1.0646
64 P A -1.3894
65 S A -1.1696
66 L A 0.0000
67 K A -2.1861
68 S A -1.5367
69 R A -1.8660
70 V A 0.0000
71 T A -1.2585
72 M A 0.0000
73 S A -0.4595
74 V A -0.4660
75 D A -1.3256
76 T A -1.1378
77 S A -1.3800
78 K A -2.2072
79 N A -1.5095
80 Q A -1.3357
81 F A 0.0000
82 S A -0.5951
83 L A 0.0000
84 K A -1.8513
85 V A 0.0000
86 N A -2.2171
87 S A -1.7149
88 V A 0.0000
89 T A -0.8289
90 A A -0.3049
91 A A -0.0381
92 D A 0.0000
93 T A 0.2512
94 A A 0.0000
95 V A 0.1817
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.3998
104 F A 1.9063
105 G A 0.6947
106 V A 0.8236
107 G A 0.8697
108 T A 0.0000
109 F A 0.0000
110 D A -0.5437
111 Y A -0.6466
112 W A -0.8646
113 G A 0.0000
114 Q A -1.6383
115 G A -0.7718
116 T A -0.2142
117 L A 0.8092
118 V A 0.0000
119 T A 0.3128
120 V A 0.0000
121 S A -0.4148
122 S A -0.6624
123 A A -0.6647
124 A A -0.3642
125 G A -0.8435
126 G A -1.0831
127 G A -1.1264
128 G A -1.1731
129 S A -1.0347
130 G A -1.1564
131 G A -1.2038
132 G A -1.2040
133 G A -1.2235
134 S A -1.0192
135 G A -1.1910
136 G A -1.1912
137 G A -1.2209
138 G A -1.2093
139 S A -1.0346
140 D A -1.0464
141 I A -0.2161
142 V A 0.9457
143 M A 0.0000
144 T A -0.5901
145 Q A -0.6653
146 S A -0.7187
147 P A -0.3375
148 A A -0.3511
149 T A -0.4591
150 L A -0.2240
151 S A -0.3631
152 L A -0.6805
153 S A -0.9877
154 P A -1.5199
155 G A -1.8071
156 E A -2.3934
157 R A -2.6843
158 A A 0.0000
159 T A -0.6689
160 L A 0.0000
161 S A -0.8886
162 V A 0.0000 mutated: AV162A
163 R A -2.3270
164 A A 0.0000
165 S A -0.8819
166 Q A -1.5931
167 S A -1.2320
168 V A 0.0000
169 S A -0.4949
170 S A -0.2089
171 Y A 0.7069
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4928
179 P A -0.9735
180 G A -0.9567
181 C A -1.0939
182 Q A -1.4931
183 A A -1.1599
184 P A 0.0000
185 R A -1.5311
186 L A -0.7947
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4044
190 D A -0.5048
191 A A 0.0000
192 S A -1.0610
193 N A -1.5735
194 R A -2.0208
195 A A -1.2299
196 T A -0.7326
197 G A -0.7409
198 I A 0.0000
199 P A -0.5260
200 A A -0.4865
201 R A -0.7336
202 F A 0.0000
203 S A -0.8538
204 G A -0.8282
205 S A -0.7972
206 G A -1.0997
207 S A -0.9327
208 G A -1.0583
209 T A -1.7535
210 D A -2.1711
211 F A 0.0000
212 T A -0.7862
213 L A 0.0000
214 T A -0.6132
215 I A 0.0000
216 S A -1.3691
217 S A -1.7282
218 L A 0.0000
219 E A -2.2949
220 P A -1.5263
221 E A -2.3731
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.6491
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1243
233 S A -0.3135
234 T A -0.4840
235 P A -0.5719
236 L A 0.0000
237 T A 0.1033
238 F A 0.2448
239 G A 0.0000
240 G A -0.8094
241 G A -0.7858
242 T A 0.0000
243 K A -0.8892
244 A A 0.0000
245 E A -0.4903
246 I A 0.6720
247 K A -0.8823
248 A A -0.3455
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5425 4.8898 View CSV PDB
4.5 -0.5637 4.8797 View CSV PDB
5.0 -0.5882 4.8562 View CSV PDB
5.5 -0.6104 4.815 View CSV PDB
6.0 -0.6237 4.7605 View CSV PDB
6.5 -0.6234 4.6994 View CSV PDB
7.0 -0.6103 4.636 View CSV PDB
7.5 -0.589 4.5718 View CSV PDB
8.0 -0.563 4.5074 View CSV PDB
8.5 -0.5335 4.4433 View CSV PDB
9.0 -0.5008 4.3803 View CSV PDB