Project name: afd8cc0169e34da

Status: done

Started: 2026-06-06 21:46:34
Chain sequence(s) B: QVQLVESGGGLVQPGGSLRLSCAASGFPFSSYGMGWVRQAPGKGLEWVSGINWSGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCADGLLFSYDDWGQGTQVTVSS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/afd8cc0169e34da/tmp/folded.pdb                (00:01:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:42)
Show buried residues

Minimal score value
-2.9607
Maximal score value
3.1711
Average score
-0.5686
Total score value
-66.5311

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q B -1.4466
2 V B -1.1028
3 Q B -1.2162
4 L B 0.0000
5 V B 0.8010
6 E B 0.0000
7 S B -0.6159
8 G B -1.0367
9 G B -0.8286
10 G B -0.0674
11 L B 0.8974
12 V B 0.0000
13 Q B -1.5496
14 P B -1.8855
15 G B -1.5865
16 G B -1.0593
17 S B -1.3268
18 L B -0.9221
19 R B -2.1202
20 L B 0.0000
21 S B -0.4067
22 C B 0.0000
23 A B -0.2760
24 A B 0.0000
25 S B -0.9773
26 G B -0.9815
27 F B -0.4690
28 P B -0.4201
29 F B 0.0000
30 S B -0.7099
31 S B 0.0216
32 Y B 0.8461
33 G B 1.0262
34 M B 0.0000
35 G B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B -0.8330
40 A B -1.3518
41 P B -0.9916
42 G B -1.4621
43 K B -2.1918
44 G B -1.0874
45 L B 0.2024
46 E B -0.6308
47 W B 0.0768
48 V B 0.0000
49 S B 0.0000
50 G B 0.1335
51 I B 0.0000
52 N B 0.1720
53 W B 0.0353
54 S B -0.5293
55 G B -0.8403
56 G B -0.7365
57 S B -0.6250
58 T B -0.4504
59 G B -0.6251
60 Y B -0.9465
61 A B -1.4386
62 D B -2.5086
63 S B -1.7319
64 V B 0.0000
65 K B -2.6582
66 G B -1.7863
67 R B -1.5553
68 F B 0.0000
69 T B -0.8809
70 I B 0.0000
71 S B -0.5919
72 R B -1.1837
73 D B -1.8856
74 N B -2.2889
75 A B -1.7373
76 K B -2.5502
77 N B -2.1736
78 T B 0.0000
79 L B 0.0000
80 Y B -0.5978
81 L B 0.0000
82 Q B -1.2413
83 M B 0.0000
84 N B -1.5007
85 S B -1.4170
86 L B 0.0000
87 R B -2.9607
88 A B -2.0722
89 E B -2.4492
90 D B 0.0000
91 T B -0.9982
92 A B 0.0000
93 V B -0.1595
94 Y B 0.0000
95 Y B 0.0968
96 C B 0.0000
97 A B 0.0000
98 D B 0.0000
99 G B 0.0000
100 L B 2.5613
101 L B 3.1711
102 F B 2.7815
103 S B 1.2794
104 Y B 0.2760
105 D B -1.3621
106 D B -1.4440
107 W B -0.4012
108 G B -0.3100
109 Q B -0.9032
110 G B -0.5177
111 T B -0.7068
112 Q B -0.9789
113 V B 0.0000
114 T B -0.4055
115 V B 0.0000
116 S B -0.6847
117 S B -0.5215
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3378 5.1275 View CSV PDB
4.5 -0.3696 5.1069 View CSV PDB
5.0 -0.4069 5.073 View CSV PDB
5.5 -0.4435 5.03 View CSV PDB
6.0 -0.4719 4.9829 View CSV PDB
6.5 -0.4872 4.9344 View CSV PDB
7.0 -0.4907 4.8853 View CSV PDB
7.5 -0.487 4.8362 View CSV PDB
8.0 -0.4792 4.7874 View CSV PDB
8.5 -0.4673 4.7396 View CSV PDB
9.0 -0.4508 4.6947 View CSV PDB