Project name: b0ed0eb6d84f2af

Status: done

Started: 2026-06-16 09:17:07
Chain sequence(s) A: MRYYAQHSAAAYCNIGTRAGQQITCGNNACPLVAQNRAKVVTSVVGGLTGAGAYVAIDHVRREIVVSIRGSNNIRNYITNLIFSWSDCDFTTKCQVHAGFAQAWDEIKVAVNKAITPATRGKRQYAVVFTGHSLGGAVATLGAAYLRRSGLHVRLYTYGSPRVGNDRFASWFSNIQGGQWRVTHEDDPVPRLPPSFSGYRHITPEYWLSGGNGGNTYKTDYTIANVKVCEGIDSTQCNAGRDVTDINAHLYYFGAIASCAPSSLQLRDADGQDDPLPKDVSERLADWSRKDQEFAKNENI
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations No
alphaCutter usage Used: no changes made
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:43)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:54:23)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:54:25)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:54:26)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:54:27)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:54:28)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:54:30)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:54:31)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:54:32)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:54:33)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:54:35)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:54:36)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:54:38)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:54:39)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:54:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:54:45)
Show buried residues

Minimal score value
-2.4059
Maximal score value
1.84
Average score
-0.2625
Total score value
-78.7623

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.9440
2 R A -0.2423
3 Y A 0.5989
4 Y A 0.2716
5 A A 0.0000
6 Q A 0.0000
7 H A 0.0000
8 S A 0.0000
9 A A 0.0000
10 A A 0.0000
11 A A 0.0000
12 Y A 0.0000
13 C A -0.1630
14 N A -1.2565
15 I A 0.0000
16 G A -0.4689
17 T A -0.4628
18 R A -1.8376
19 A A -0.2829
20 G A -0.2525
21 Q A -0.8069
22 Q A -1.4293
23 I A -0.0157
24 T A -0.0123
25 C A -0.0097
26 G A -0.4968
27 N A -0.5805
28 N A -1.3204
29 A A 0.0000
30 C A 0.0000
31 P A 0.0015
32 L A 0.4738
33 V A 0.0000
34 A A -0.4335
35 Q A -1.3949
36 N A -1.6349
37 R A -2.0433
38 A A 0.0000
39 K A -1.6923
40 V A 0.0000
41 V A 0.3112
42 T A -0.2530
43 S A -0.0717
44 V A 0.5300
45 V A 1.7687
46 G A 0.0711
47 G A -0.4331
48 L A 0.5074
49 T A 0.0442
50 G A -0.3806
51 A A 0.0000
52 G A 0.1046
53 A A 0.0000
54 Y A 0.0000
55 V A 0.0000
56 A A 0.0000
57 I A 0.5151
58 D A -0.3062
59 H A -0.8082
60 V A 1.1612
61 R A -1.6540
62 R A -1.1402
63 E A -0.4576
64 I A 0.0000
65 V A 0.0000
66 V A 0.0000
67 S A 0.0000
68 I A 0.0000
69 R A -0.2259
70 G A 0.0000
71 S A -0.0345
72 N A 0.0000
73 N A -0.1639
74 I A 0.0000
75 R A 0.0000
76 N A -0.3163
77 Y A 0.0003
78 I A 0.0000
79 T A -0.2774
80 N A -0.9540
81 L A 1.3732
82 I A 0.8707
83 F A 1.5395
84 S A 0.4110
85 W A 1.1490
86 S A 0.0063
87 D A -0.8475
88 C A 0.0000
89 D A -1.7472
90 F A -0.1487
91 T A -0.0337
92 T A -0.3579
93 K A -1.7030
94 C A 0.0000
95 Q A -0.5427
96 V A 0.0000
97 H A 0.0132
98 A A -0.0349
99 G A -0.2665
100 F A 0.0000
101 A A -0.2185
102 Q A -1.3479
103 A A 0.0000
104 W A -0.0965
105 D A -1.8200
106 E A -2.0738
107 I A 0.0000
108 K A -0.1950
109 V A 1.6613
110 A A 0.1762
111 V A 0.0661
112 N A -0.4519
113 K A -1.7652
114 A A 0.0000
115 I A 0.0000
116 T A -0.0787
117 P A -0.2564
118 A A -0.0370
119 T A -0.3992
120 R A -1.9068
121 G A -1.0030
122 K A -2.2735
123 R A -2.4059
124 Q A -1.7025
125 Y A 0.0636
126 A A 0.0305
127 V A 0.0000
128 V A 0.0000
129 F A 0.0000
130 T A 0.0000
131 G A 0.0000
132 H A 0.0000
133 S A 0.0000
134 L A 0.0000
135 G A 0.0000
136 G A 0.0000
137 A A 0.0000
138 V A 0.0000
139 A A 0.0000
140 T A 0.0000
141 L A 0.0000
142 G A -0.0967
143 A A 0.0000
144 A A 0.0000
145 Y A 0.7493
146 L A 0.0000
147 R A -0.6699
148 R A -1.9200
149 S A -0.5186
150 G A -0.4351
151 L A 0.0539
152 H A -0.5537
153 V A 0.0000
154 R A -0.8846
155 L A 0.0000
156 Y A 0.0000
157 T A 0.0000
158 Y A 0.0000
159 G A 0.0000
160 S A 0.0000
161 P A 0.0000
162 R A -0.2224
163 V A 0.0000
164 G A 0.0000
165 N A -0.3135
166 D A -0.9622
167 R A -1.2472
168 F A 0.0000
169 A A 0.0000
170 S A 0.0249
171 W A 0.3190
172 F A 0.0000
173 S A -0.2956
174 N A -1.1902
175 I A -0.0032
176 Q A 0.0000
177 G A -0.2497
178 G A -0.4971
179 Q A 0.0000
180 W A 0.4794
181 R A 0.0000
182 V A 0.0000
183 T A 0.0000
184 H A 0.0000
185 E A 0.0000
186 D A 0.0000
187 D A 0.0000
188 P A 0.0000
189 V A 0.0000
190 P A 0.0000
191 R A 0.0000
192 L A 0.2347
193 P A 0.0000
194 P A 0.0000
195 S A 0.0000
196 F A 0.6691
197 S A -0.0886
198 G A -0.0821
199 Y A 0.0874
200 R A 0.0000
201 H A 0.0000
202 I A 0.0000
203 T A 0.0000
204 P A -0.0967
205 E A 0.0000
206 Y A 0.4006
207 W A 0.0000
208 L A 0.0000
209 S A -0.0775
210 G A -0.2843
211 G A -0.5580
212 N A -1.4138
213 G A -0.7979
214 G A -0.5989
215 N A -0.3256
216 T A 0.0417
217 Y A 0.3435
218 K A -0.9952
219 T A -0.3271
220 D A -0.3273
221 Y A 1.1958
222 T A 0.5368
223 I A 1.7336
224 A A 0.1934
225 N A -1.0913
226 V A 0.6072
227 K A -0.1093
228 V A 1.6739
229 C A 0.0000
230 E A -1.8536
231 G A -0.3631
232 I A 0.6978
233 D A -0.5214
234 S A -0.0812
235 T A 0.0000
236 Q A -0.3486
237 C A 0.0000
238 N A 0.0000
239 A A 0.0000
240 G A -0.3925
241 R A -0.8878
242 D A -1.0706
243 V A 0.0000
244 T A -0.1245
245 D A -0.3947
246 I A 0.0000
247 N A -0.4538
248 A A 0.0000
249 H A 0.0000
250 L A 0.1997
251 Y A 0.0000
252 Y A 0.0000
253 F A 0.0000
254 G A 0.0000
255 A A -0.0666
256 I A 0.0000
257 A A -0.0304
258 S A -0.2108
259 C A 0.0000
260 A A -0.0479
261 P A -0.2640
262 S A -0.1359
263 S A 0.0000
264 L A 0.0000
265 Q A -0.4603
266 L A 0.0000
267 R A -1.9669
268 D A 0.0000
269 A A -0.2844
270 D A -1.8688
271 G A -0.9128
272 Q A -0.7257
273 D A -1.3454
274 D A -1.9550
275 P A -0.6030
276 L A 0.0000
277 P A -0.4093
278 K A -2.0543
279 D A -2.2570
280 V A -0.2286
281 S A -0.4928
282 E A -2.1921
283 R A -1.4333
284 L A 0.0000
285 A A -0.2067
286 D A -1.1575
287 W A 0.3616
288 S A 0.0000
289 R A -2.0776
290 K A -1.4069
291 D A 0.0000
292 Q A -0.8489
293 E A -1.7108
294 F A 0.5635
295 A A -0.3464
296 K A -1.9410
297 N A -1.9386
298 E A -2.2308
299 N A -0.8702
300 I A 1.8400
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.2625 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_1 -0.2625 View CSV PDB
model_3 -0.275 View CSV PDB
model_8 -0.2848 View CSV PDB
model_2 -0.287 View CSV PDB
model_7 -0.2874 View CSV PDB
input -0.2929 View CSV PDB
CABS_average -0.2986 View CSV PDB
model_0 -0.2992 View CSV PDB
model_11 -0.301 View CSV PDB
model_4 -0.3028 View CSV PDB
model_6 -0.3098 View CSV PDB
model_5 -0.3158 View CSV PDB
model_10 -0.3272 View CSV PDB
model_9 -0.3303 View CSV PDB