Project name: AAAV_R3

Status: done

Started: 2026-08-21 08:48:49
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:09)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b2ac4491600f719/tmp/folded.pdb                (00:02:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:44)
Show buried residues

Minimal score value
-2.7323
Maximal score value
1.9161
Average score
-0.556
Total score value
-137.8792

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6195
2 V A -1.3173
3 Q A -1.9745
4 L A 0.0000
5 Q A -1.8535
6 E A 0.0000
7 S A -0.6782
8 G A -0.3975
9 P A -0.0355
10 G A 0.2562
11 L A 0.7449
12 V A 0.0000
13 K A -1.6842
14 P A -1.2860
15 S A -1.3764
16 Q A -1.8799
17 T A -1.5018
18 L A 0.0000
19 S A -0.8331
20 L A 0.0000
21 T A -0.6285
22 A A 0.0000
23 T A -1.2424
24 V A 0.0000
25 S A -1.3402
26 G A -1.3541
27 G A -1.0413
28 S A -0.6178
29 I A 0.0000
30 S A -0.2590
31 S A -0.3335
32 G A -0.1253
33 D A -0.1026
34 Y A 0.5587
35 Y A 0.5480
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.3954
41 Q A 0.0000
42 P A -0.7312
43 P A -0.6912
44 G A -1.1328
45 C A -1.2390
46 K A -2.0574
47 G A -1.2766
48 L A 0.0000
49 E A -0.7728
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1162
54 I A 0.0000
55 Y A 0.3517
56 Y A 0.3012
57 S A -0.0676
58 G A -0.3172
59 S A -0.2996
60 T A -0.2748
61 D A -0.7117
62 Y A -0.7097
63 N A -0.8937
64 P A -1.1679
65 S A -1.0942
66 L A 0.0000
67 K A -2.0904
68 S A -1.4098
69 R A -1.6031
70 V A 0.0000
71 T A -0.9701
72 M A 0.0000
73 S A -0.3607
74 V A -0.3975
75 D A -1.2102
76 T A -1.0330
77 S A -1.3380
78 K A -2.1819
79 N A -1.4555
80 Q A -1.2724
81 F A 0.0000
82 S A -0.4631
83 L A 0.0000
84 K A -1.2713
85 V A 0.0000
86 N A -1.6678
87 S A -1.4645
88 V A 0.0000
89 T A -0.6580
90 A A -0.2314
91 A A -0.0813
92 D A 0.0000
93 T A 0.2393
94 A A 0.0000
95 V A 0.1887
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7146
103 I A 1.3984
104 F A 1.9161
105 G A 0.6663
106 V A 0.6924
107 G A 0.7008
108 T A 0.0000
109 F A 0.0000
110 D A -0.4520
111 Y A -0.5482
112 W A -0.7884
113 G A 0.0000
114 Q A -1.6300
115 G A -0.7629
116 T A -0.1939
117 L A 0.8225
118 V A 0.0000
119 T A 0.2897
120 V A 0.0000
121 S A -0.3468
122 S A -0.6695
123 A A -0.4961
124 A A -0.3553
125 G A -0.8380
126 G A -1.0753
127 G A -1.1484
128 G A -1.1676
129 S A -1.0088
130 G A -1.1995
131 G A -1.1783
132 G A -1.2306
133 G A -1.1710
134 S A -1.0979
135 G A -1.2790
136 G A -1.3602
137 G A -1.2601
138 G A -1.1078
139 S A -0.8238
140 D A -0.7579
141 I A -0.0213
142 V A 1.0714
143 M A 0.0000
144 T A -0.6368
145 Q A -0.6829
146 S A -0.7385
147 P A -0.3464
148 A A -0.3525
149 T A -0.4595
150 L A -0.2136
151 S A -0.3863
152 L A -0.6901
153 S A -1.0241
154 P A -1.5536
155 G A -1.8473
156 E A -2.4068
157 R A -2.7323
158 A A 0.0000
159 T A -0.6466
160 L A 0.0000
161 S A -0.9863
162 A A 0.0000
163 R A -2.4825
164 A A 0.0000
165 S A -0.8755
166 Q A -1.5926
167 S A -1.2928
168 V A 0.0000
169 S A -0.5381
170 S A -0.3135
171 Y A 0.7428
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3163
179 P A -0.8238
180 G A -0.9244
181 C A -0.9792
182 Q A -1.4393
183 A A -1.0900
184 P A 0.0000
185 R A -1.2831
186 L A -0.6429
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4933
190 D A -0.6613
191 A A 0.0000
192 S A -1.1648
193 N A -1.7376
194 R A -1.6334
195 A A -1.0366
196 T A -0.6332
197 G A -0.6357
198 I A 0.0000
199 P A -0.4361
200 A A -0.3980
201 R A -0.8070
202 F A 0.0000
203 S A -0.7771
204 G A -0.8205
205 S A -0.9602
206 G A -1.3001
207 S A -1.0897
208 G A -1.1883
209 T A -1.9947
210 D A -2.6990
211 F A 0.0000
212 T A -0.8904
213 L A 0.0000
214 T A -0.6315
215 I A 0.0000
216 S A -1.5078
217 S A -1.8440
218 L A 0.0000
219 E A -2.3970
220 P A -1.5796
221 E A -2.3768
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.6306
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.0856
233 S A -0.2354
234 T A -0.4116
235 P A -0.2177
236 L A 0.0000
237 T A 0.1968
238 F A 0.2460
239 G A 0.0000
240 G A -0.8307
241 G A -0.7974
242 T A 0.0000
243 K A -0.8253
244 A A 0.0000
245 E A -0.5493
246 I A 0.6404
247 K A -0.9036
248 A A -0.3603
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5061 4.7928 View CSV PDB
4.5 -0.5302 4.7538 View CSV PDB
5.0 -0.5576 4.7054 View CSV PDB
5.5 -0.5825 4.653 View CSV PDB
6.0 -0.5988 4.5992 View CSV PDB
6.5 -0.602 4.5449 View CSV PDB
7.0 -0.5925 4.4906 View CSV PDB
7.5 -0.5747 4.4367 View CSV PDB
8.0 -0.5521 4.3841 View CSV PDB
8.5 -0.5257 4.3353 View CSV PDB
9.0 -0.4955 4.2952 View CSV PDB