Project name: b307b3e584332e9

Status: done

Started: 2026-03-18 16:02:39
Chain sequence(s) A: TFTNIGNGNQYNATDGPQNINQGGNQVTGGTFPGTVNF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       CABS:     Running CABS flex simulation                                                (00:00:12)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:05:49)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:05:50)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:05:50)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:05:50)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:05:50)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:53)
Show buried residues

Minimal score value
-2.2956
Maximal score value
2.9264
Average score
-0.3776
Total score value
-14.3504

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 T A 0.1579
2 F A 1.5319
3 T A 0.6201
4 N A 0.0000
5 I A 2.1551
6 G A 0.4625
7 N A -0.2720
8 G A -0.9458
9 N A -1.6043
10 Q A -1.5098
11 Y A -1.1660
12 N A -1.7920
13 A A -1.3980
14 T A -1.2605
15 D A -1.8876
16 G A -1.3756
17 P A -1.1614
18 Q A 0.0000
19 N A -1.6026
20 I A 0.0000
21 N A -2.2956
22 Q A 0.0000
23 G A -1.5234
24 G A -1.7175
25 N A -1.9001
26 Q A -2.0926
27 V A -0.4602
28 T A -0.7059
29 G A -0.6490
30 G A -0.8774
31 T A -0.6881
32 F A 0.2937
33 P A -0.0303
34 G A 0.4641
35 T A 1.4435
36 V A 2.9264
37 N A 2.2307
38 F A 2.2794
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.3776 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_2 -0.3776 View CSV PDB
model_6 -0.3895 View CSV PDB
model_1 -0.5319 View CSV PDB
CABS_average -0.6263 View CSV PDB
model_0 -0.6282 View CSV PDB
model_9 -0.6304 View CSV PDB
model_3 -0.6397 View CSV PDB
model_5 -0.6916 View CSV PDB
model_8 -0.7053 View CSV PDB
model_11 -0.7119 View CSV PDB
model_7 -0.7295 View CSV PDB
model_4 -0.7357 View CSV PDB
model_10 -0.7436 View CSV PDB
input -0.9844 View CSV PDB