Project name: Y135D

Status: done

Started: 2026-08-16 07:24:13
Chain sequence(s) A: QCIQPGTGYNNGYFYSYWNDGHGGVTYCNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFDQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:21)
Show buried residues
Minimal score value
-2.4411
Maximal score value
1.9551
Average score
-0.5098
Total score value
-96.8664
Download the table (csv)

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.7316
2 C A 0.2216
3 I A 0.0012
4 Q A -0.8010
5 P A -0.6643
6 G A -0.4349
7 T A 0.0272
8 G A 0.4355
9 Y A 0.8318
10 N A -0.5039
11 N A -1.4155
12 G A -0.7405
13 Y A -0.1981
14 F A 0.0000
15 Y A 0.2435
16 S A 0.2383
17 Y A 0.0000
18 W A -0.0953
19 N A -0.8966
20 D A -1.3251
21 G A -1.4713
22 H A -1.6526
23 G A -1.4582
24 G A -1.2119
25 V A -1.0468
26 T A -0.4316
27 Y A 0.0000
28 C A -0.1830
29 N A 0.0000
30 G A -0.8140
31 P A -1.0559
32 G A -1.0700
33 G A 0.0000
34 Q A -0.8781
35 F A 0.0000
36 S A -0.5331
37 V A 0.0000
38 N A -1.5441
39 W A 0.0000
40 S A -1.1742
41 N A -1.1742
42 S A 0.0000
43 G A 0.0000
44 N A -0.1140
45 F A 0.0000
46 V A 0.2000
47 G A 0.0000
48 G A 0.0000
49 K A 0.0000
50 G A 0.0000
51 W A 0.0612
52 Q A -0.2668
53 P A -0.4412
54 G A 0.0000
55 T A -1.0169
56 K A -1.8916
57 N A -2.0241
58 K A -1.0524
59 V A 0.0262
60 I A 0.0000
61 N A -1.0127
62 F A 0.0000
63 S A -0.7181
64 G A -0.5572
65 S A -0.7166
66 Y A -0.9238
67 N A -1.7869
68 P A -1.5807
69 N A -1.7021
70 G A -0.5560
71 N A 0.2134
72 S A 0.0000
73 Y A 0.0000
74 L A 0.0000
75 S A 0.0000
76 V A 0.0000
77 Y A 0.0000
78 G A 0.0000
79 W A 0.0000
80 S A 0.0000
81 R A -1.7242
82 N A -2.0199
83 P A -1.3824
84 L A -0.6145
85 I A 0.0000
86 E A 0.0000
87 Y A 0.0000
88 Y A 0.0000
89 I A 0.0000
90 V A 0.0000
91 E A 0.0000
92 N A -0.8997
93 F A -0.3674
94 G A -0.6339
95 T A -0.2267
96 Y A 0.3410
97 N A -0.3092
98 P A 0.0000
99 S A 0.0000
100 T A -0.5354
101 G A -0.9144
102 A A -1.1589
103 T A -1.3789
104 K A -2.1455
105 L A -1.1915
106 G A -1.4663
107 E A -1.9362
108 V A -0.8543
109 T A -0.4737
110 S A 0.0000
111 D A -0.9416
112 G A -0.8762
113 S A 0.0000
114 V A -0.7778
115 Y A 0.0000
116 D A -1.3477
117 I A 0.0000
118 Y A 0.0000
119 R A -1.8088
120 T A -1.5379
121 Q A -1.7280
122 R A -1.1828
123 V A 0.1838
124 N A -1.1093
125 Q A -1.1061
126 P A -0.3181
127 S A 0.3492
128 I A 1.3085
129 I A 1.9551
130 G A 0.4814
131 T A -0.1930
132 A A -0.0558
133 T A -0.4997
134 F A 0.0000
135 D A -0.9757
136 Q A 0.0000
137 Y A 0.0000
138 W A 0.0000
139 S A 0.0000
140 V A 0.0000
141 R A 0.0000
142 R A -2.3906
143 N A -2.4411
144 H A -1.8797
145 R A -1.2333
146 S A -0.6826
147 S A -0.7017
148 G A -0.7785
149 S A -0.6072
150 V A 0.0000
151 N A -0.7916
152 T A 0.0000
153 A A 0.0000
154 N A -1.3498
155 H A 0.0000
156 F A 0.0000
157 N A -2.1169
158 A A -1.6243
159 W A 0.0000
160 A A -1.3518
161 Q A -1.9373
162 Q A -1.6262
163 G A -1.1945
164 L A 0.0000
165 T A -0.7650
166 L A 0.0000
167 G A -1.1617
168 T A -1.0287
169 M A -0.7899
170 D A 0.0000
171 Y A 0.0000
172 Q A 0.0000
173 I A 0.0000
174 V A 0.0000
175 A A 0.0000
176 V A 0.0000
177 E A 0.0331
178 G A 0.0000
179 Y A 1.3208
180 F A 1.4954
181 S A 0.0000
182 S A -1.0558
183 G A -1.5753
184 S A -1.3177
185 A A 0.0000
186 S A -0.6766
187 I A 0.0000
188 T A -0.6902
189 V A 0.0000
190 S A -0.5082
Download PDB file
View in 3Dmol