Project name: HSA6A7_prot3D_74_015M

Status: done

Started: 2026-02-25 09:09:36
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQTYDYSTRSWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGSPRGGMDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:25)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b3ab6dbb0973c54/tmp/folded.pdb                (00:01:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:41)
Show buried residues

Minimal score value
-2.8324
Maximal score value
1.5254
Average score
-0.5464
Total score value
-125.6715

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.1895
2 S A -0.0186
3 V A 1.3848
4 L A 0.0000
5 T A 0.0731
6 Q A 0.0000
7 P A -0.3869
8 P A -0.5705
9 S A -0.4310
11 V A -0.0254
12 S A -0.1240
13 G A 0.0000
14 A A -0.2051
15 P A -0.9331
16 G A -1.8229
17 Q A -2.3786
18 R A -2.6832
19 V A 0.0000
20 T A -0.5077
21 I A 0.0000
22 S A -0.2930
23 C A 0.0000
24 T A -0.2024
25 G A -0.0121
26 S A -0.1435
27 S A -0.5033
28 S A 0.0253
29 N A 0.0000
30 I A 0.0000
31 G A -0.8539
35 A A -0.2265
36 G A -0.6030
37 Y A 0.0118
38 D A -0.7106
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.3849
44 Q A 0.0000
45 L A -0.0204
46 P A -0.3306
47 G A -0.3537
48 T A -0.3465
49 A A -0.4542
50 P A 0.0000
51 K A -1.1151
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -1.2710
56 G A -1.3110
57 N A -1.0869
65 S A -1.4015
66 N A -2.2244
67 R A -2.2266
68 P A -1.3801
69 S A -0.8335
70 G A -0.9720
71 V A -0.8299
72 P A -1.2865
74 D A -2.1840
75 R A -1.5094
76 F A 0.0000
77 S A -0.8977
78 G A -0.7802
79 S A -0.5997
80 K A -1.0117
83 S A -0.8024
84 G A -0.9410
85 T A -0.7358
86 S A -0.6381
87 A A 0.0000
88 S A -0.3986
89 L A 0.0000
90 A A 0.0000
91 I A 0.0000
92 T A -1.8869
93 G A -1.8605
94 L A 0.0000
95 Q A -1.5483
96 A A -1.2259
97 E A -2.1254
98 D A 0.0000
99 E A -1.3327
100 A A 0.0000
101 D A -0.5924
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 T A 0.0000
107 Y A 0.2222
108 D A 0.0000
109 Y A 0.5590
110 S A -0.2487
113 T A -0.9267
114 R A -1.4293
115 S A 0.0000
116 W A 0.0000
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4807
121 G A 0.0000
122 T A 0.0000
123 K A -0.6471
124 V A 0.0000
125 T A 0.1183
126 V A 0.2854
127 L A 1.3502
1 Q B -0.9068
2 V B 0.1423
3 Q B -0.4383
4 L B 0.0000
5 V B 0.7640
6 Q B 0.0629
7 S B -0.6532
8 G B -0.8851
9 G B -0.5510
11 G B 0.4535
12 V B 1.5254
13 V B 0.1258
14 Q B -1.6041
15 P B -2.2451
16 G B -2.2110
17 R B -2.8324
18 S B -1.9416
19 L B -1.2268
20 R B -2.0786
21 L B 0.0000
22 S B -0.5148
23 C B 0.0000
24 A B -0.1901
25 A B -0.1819
26 S B -0.3682
27 G B -0.3711
28 F B -0.0303
29 T B -0.3123
30 F B -0.2861
35 S B 0.0668
36 S B 0.4196
37 Y B 0.7010
38 G B 0.3978
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.7366
45 A B -0.9819
46 P B -0.9547
47 G B -1.4723
48 K B -2.2171
49 G B -1.4213
50 L B 0.0000
51 E B -0.7062
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.1619
58 Y B 0.4717
59 D B -1.5221
62 G B -0.9222
63 S B -0.7952
64 N B -0.5714
65 K B -0.5758
66 Y B -0.2833
67 Y B -0.9588
68 A B 0.0000
69 D B -2.6964
70 S B -1.9450
71 V B 0.0000
72 K B -2.5034
74 G B -1.6661
75 R B 0.0000
76 F B 0.0000
77 T B -0.7334
78 I B 0.0000
79 S B -0.7281
80 R B -1.1994
81 D B -1.5804
82 N B -1.5616
83 S B -1.4874
84 K B -2.2113
85 N B -1.4884
86 T B -0.9189
87 L B 0.0000
88 Y B -0.5239
89 L B 0.0000
90 Q B -1.1733
91 M B 0.0000
92 N B -2.1263
93 S B -1.9490
94 L B 0.0000
95 R B -2.6633
96 A B -1.5702
97 E B -1.6978
98 D B 0.0000
99 T B -0.2711
100 A B 0.0000
101 V B 0.1723
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.4825
107 D B 0.0000
108 G B -0.7777
109 S B -0.7271
110 P B -1.0505
112 R B -2.0399
113 G B -1.5605
114 G B 0.0000
115 M B 0.0000
116 D B -1.2447
117 V B -0.6956
118 W B 0.0000
119 G B 0.0000
120 Q B -0.9149
121 G B -0.4425
122 T B 0.0000
123 T B 0.0895
124 V B 0.0000
125 T B 0.3439
126 V B -0.6476
127 S B -0.4213
128 S B -0.4960
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5517 2.2506 View CSV PDB
4.5 -0.5819 2.2306 View CSV PDB
5.0 -0.6148 2.2072 View CSV PDB
5.5 -0.6457 2.184 View CSV PDB
6.0 -0.6697 2.1648 View CSV PDB
6.5 -0.6832 2.1525 View CSV PDB
7.0 -0.6874 2.1468 View CSV PDB
7.5 -0.6858 2.1446 View CSV PDB
8.0 -0.6803 2.1439 View CSV PDB
8.5 -0.6702 2.1437 View CSV PDB
9.0 -0.6548 2.1436 View CSV PDB