Project name: b43a75682381216

Status: done

Started: 2026-08-21 08:01:55
Chain sequence(s) A: EIVMTQSPASLSLSQEEKVTITCRASESVEFYGTNLIQWYQQKPGQAPKLLIYGASNVETGVPSRFSGSGSGTDFTFTISSLEPEDVAVYYCQQSRKVPWTFGQGTKLEIK
B: EVQLVQSGAEVKKPGASVKVSCKTSGYTFIDYYMNWVRQAPGAGLDWMGFINPYTDYINYNQNFKDRVTLTADTSTSTAYMELSSLRAGDIAVYYCARRTYSDGTYYFDFWGQGTLVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:36)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b43a75682381216/tmp/folded.pdb                (00:01:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:42)
Show buried residues

Minimal score value
-2.219
Maximal score value
1.7544
Average score
-0.2371
Total score value
-55.0158

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8199
2 I A 0.0000
3 V A 1.7544
4 M A 0.0000
5 T A -0.0389
6 Q A 0.0000
7 S A -0.0875
8 P A -0.1209
9 A A 0.0099
10 S A -0.3252
11 L A 0.1631
12 S A -0.1874
13 L A 0.2414
14 S A -0.2319
15 Q A -1.5422
16 E A -2.2190
17 E A -1.5673
18 K A -1.8823
19 V A 0.0000
20 T A -0.0734
21 I A 0.0000
22 T A -0.0156
23 C A 0.0000
24 R A -1.3314
25 A A 0.0000
26 S A -0.5468
27 E A -1.8716
28 S A -0.4202
29 V A 0.0000
30 E A -0.7879
31 F A 0.9727
32 Y A 1.3949
33 G A -0.2237
34 T A -0.1221
35 N A -0.2766
36 L A 0.0000
37 I A 0.0000
38 Q A 0.0000
39 W A 0.0000
40 Y A 0.0000
41 Q A 0.0000
42 Q A 0.0000
43 K A -0.6845
44 P A -0.4565
45 G A -0.7345
46 Q A -1.2824
47 A A -0.2127
48 P A 0.0000
49 K A -1.2116
50 L A 0.0000
51 L A 0.0000
52 I A 0.0000
53 Y A 0.1720
54 G A -0.0178
55 A A 0.0000
56 S A -0.2757
57 N A -0.1856
58 V A 0.7379
59 E A -0.2308
60 T A -0.2273
61 G A -0.4426
62 V A 0.0879
63 P A -0.1461
64 S A -0.2978
65 R A -0.3577
66 F A 0.0000
67 S A -0.1163
68 G A -0.1399
69 S A -0.2667
70 G A -0.3160
71 S A -0.2784
72 G A -0.1671
73 T A -0.3780
74 D A -1.9205
75 F A 0.0000
76 T A -0.0218
77 F A 0.0000
78 T A -0.0299
79 I A 0.0000
80 S A -0.3132
81 S A -0.3590
82 L A 0.0000
83 E A -0.8541
84 P A -0.6707
85 E A -1.8545
86 D A 0.0000
87 V A 0.8114
88 A A 0.0000
89 V A -0.0327
90 Y A 0.0000
91 Y A 0.0000
92 C A 0.0000
93 Q A 0.0000
94 Q A 0.0000
95 S A 0.0000
96 R A -0.8791
97 K A -1.6651
98 V A 0.2201
99 P A 0.0000
100 W A 0.0000
101 T A -0.0105
102 F A 0.0000
103 G A 0.0000
104 Q A -1.1859
105 G A 0.0000
106 T A 0.0000
107 K A -1.6745
108 L A 0.0000
109 E A -1.2272
110 I A -0.0985
111 K A -1.6157
1 E B -1.8285
2 V B -0.3851
3 Q B -0.9867
4 L B 0.0000
5 V B 1.6141
6 Q B 0.0000
7 S B -0.1444
8 G B -0.4663
9 A B -0.0168
10 E B -0.1549
11 V B 1.6024
12 K B -0.4095
13 K B -1.7906
14 P B -0.4672
15 G B -0.4989
16 A B -0.0878
17 S B -0.0940
18 V B 0.0000
19 K B -1.5225
20 V B 0.0000
21 S B -0.0119
22 C B 0.0000
23 K B -1.0363
24 T B 0.0000
25 S B -0.2459
26 G B -0.6093
27 Y B 0.1050
28 T B -0.0264
29 F B 0.0000
30 I B 0.4068
31 D B -1.6185
32 Y B 0.0568
33 Y B 0.2783
34 M B 0.0000
35 N B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B -0.2523
39 Q B -0.1801
40 A B -0.0531
41 P B -0.3378
42 G B -0.5075
43 A B -0.0768
44 G B -0.1168
45 L B 0.0000
46 D B -1.6985
47 W B 0.0000
48 M B 0.0000
49 G B 0.0000
50 F B 0.0000
51 I B 0.0000
52 N B -0.1267
53 P B 0.0000
54 Y B 1.3676
55 T B -0.1563
56 D B -1.6350
57 Y B 0.6652
58 I B 0.5793
59 N B -0.1283
60 Y B 0.4060
61 N B 0.0000
62 Q B -1.4319
63 N B -1.4928
64 F B 0.0000
65 K B -2.0276
66 D B -2.1679
67 R B -0.6950
68 V B 0.0000
69 T B -0.0546
70 L B 0.0000
71 T B -0.0405
72 A B -0.1354
73 D B -0.7445
74 T B -0.2436
75 S B -0.2288
76 T B -0.0716
77 S B -0.0605
78 T B 0.0000
79 A B 0.0000
80 Y B 0.2378
81 M B 0.0000
82 E B -0.9522
83 L B 0.0000
84 S B -0.1383
85 S B -0.2338
86 L B 0.0000
87 R B -1.8333
88 A B -0.3677
89 G B -0.4554
90 D B 0.0000
91 I B 0.5145
92 A B 0.0000
93 V B 0.5565
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 A B 0.0000
98 R B 0.0000
99 R B -0.2106
100 T B 0.1961
101 Y B 1.3481
102 S B -0.1672
103 D B -1.8287
104 G B -0.4643
105 T B 0.0000
106 Y B 0.5620
107 Y B 0.0000
108 F B 0.0000
109 D B -0.1525
110 F B 0.6934
111 W B 0.2637
112 G B 0.0000
113 Q B -1.2097
114 G B -0.2828
115 T B 0.0000
116 L B 0.9884
117 V B 0.0000
118 T B 0.2393
119 V B 0.0000
120 S B -0.1390
121 S B -0.2312
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.1774 2.131 View CSV PDB
4.5 -0.2003 2.1039 View CSV PDB
5.0 -0.2293 2.066 View CSV PDB
5.5 -0.259 2.0236 View CSV PDB
6.0 -0.2834 1.9835 View CSV PDB
6.5 -0.2982 1.9521 View CSV PDB
7.0 -0.3028 1.9336 View CSV PDB
7.5 -0.3001 1.9255 View CSV PDB
8.0 -0.2935 1.9225 View CSV PDB
8.5 -0.2842 1.9212 View CSV PDB
9.0 -0.2723 1.9198 View CSV PDB