Project name: b5883025676c5ff

Status: done

Started: 2026-06-01 17:54:05
Chain sequence(s) A: GCGELVWVGEPLTLRTAETITTGKYYGVWMRDPKPPTTYPYTQETTWRIDTVGTDVRRQVFEYDLISQFMQGYPSSKVHILPPRRRPPLESTGAVVYSSGSLYFQGAESRTVIRYELNNTETTVKAEKEIPPGAGYHGQQFPYSWGGYTDIDLAVVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRRKQQSVANAFIICGTLLYTVSSYTSADATVNFAYDTGTGISKTTLTIPFKNRRYKYSSSMIDYNPLEKKLFAWDNLNMVTTYDIKLS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:31)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:38:17)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:38:18)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:38:19)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:38:20)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:38:21)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:38:22)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:38:23)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:38:24)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:38:25)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:38:26)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:38:27)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:38:27)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:38:28)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:38:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:38:33)
Show buried residues

Minimal score value
-3.2085
Maximal score value
1.8561
Average score
-0.3254
Total score value
-84.2687

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
244 G A -0.3199
245 C A 0.0687
246 G A -0.5860
247 E A -0.7075
248 L A 0.0000
249 V A 1.5055
250 W A 0.0000
251 V A 0.2835
252 G A -1.0015
253 E A -1.4650
254 P A -0.7275
255 L A 0.3520
256 T A 0.3478
257 L A 0.2238
258 R A -0.3757
259 T A -0.7086
260 A A 0.0000
261 E A -2.1857
262 T A -0.9663
263 I A -0.1004
264 T A -0.3326
265 G A 0.0000
266 K A -1.3191
267 Y A 0.0000
268 G A 0.0000
269 V A 0.0000
270 W A 0.0000
271 M A 0.0000
272 R A -0.5120
273 D A 0.0000
274 P A -0.4039
275 K A 0.0000
276 P A -0.3838
277 T A -0.3144
278 Y A 0.0000
279 P A 0.2029
280 Y A 1.1664
281 T A 0.2947
282 Q A -0.2140
283 E A -0.3125
284 T A 0.0000
285 T A 0.0000
286 W A 0.0000
287 R A 0.0000
288 I A 0.0000
289 D A 0.0000
290 T A 0.0000
291 V A 0.5432
292 G A -0.2052
293 T A -0.8089
294 D A -1.8001
295 V A 0.0000
296 R A -1.7120
297 Q A -0.3135
298 V A 0.0000
299 F A 0.8363
300 E A 0.0000
301 Y A 0.5143
302 D A 0.0000
303 L A 1.0463
304 I A 0.6119
305 S A 0.1648
306 Q A 0.2075
307 F A 0.0000
308 M A 0.3441
309 Q A -0.6531
310 G A 0.0000
311 Y A 0.8766
312 P A 0.3919
313 S A 0.0035
314 K A 0.0079
315 V A 1.3542
316 H A 0.7584
317 I A 1.4928
318 L A 0.0000
319 P A -0.3998
320 R A -1.4452
321 P A -1.7962
322 L A 0.0000
323 E A 0.0000
324 S A 0.0000
325 T A 0.0000
326 G A 0.0000
327 A A 0.0000
328 V A 0.0000
329 V A 0.0000
330 Y A -0.0740
331 S A -0.1839
332 G A 0.0000
333 S A 0.0000
334 L A 0.0000
335 Y A 0.0000
336 F A 0.0000
337 Q A 0.0000
338 G A 0.0000
339 A A -1.0124
340 E A -1.9624
341 S A -1.5465
342 R A 0.0000
343 T A 0.0000
344 V A 0.0000
345 I A 0.0000
346 R A -1.3091
347 Y A 0.0000
348 E A -1.2093
349 L A -0.9701
350 N A -1.5362
351 T A -0.5952
352 E A -0.3022
353 T A -0.3055
354 V A -0.1468
355 K A -1.9487
356 A A -2.2321
357 E A -2.8125
358 K A 0.0000
359 E A -2.0929
360 I A -0.7813
361 P A -0.7112
362 G A -0.7343
363 A A -0.6281
364 G A -0.2942
365 Y A 0.1813
366 H A 0.1038
367 G A -0.3413
368 Q A 0.3923
369 F A 1.8561
370 P A 0.0000
371 Y A 1.6586
372 S A 1.2138
373 W A 0.9858
374 G A 0.6648
375 G A 0.0000
376 Y A 0.0000
377 T A 0.0000
378 D A 0.0000
379 I A 0.0000
380 D A 0.0000
381 L A 0.0000
382 A A 0.0000
383 V A 0.0000
384 D A -0.0714
385 E A -0.3269
386 A A -0.1577
387 G A -0.5773
388 L A 0.0000
389 W A 0.0000
390 V A 0.0000
391 I A 0.0000
392 Y A 0.0000
393 S A 0.0000
394 T A -1.5742
395 D A -2.2589
396 E A -2.7065
397 A A -1.8727
398 K A -2.3626
399 G A 0.0000
400 A A 0.0000
401 I A 0.0000
402 V A 0.0000
403 L A 0.0000
404 S A 0.0000
405 K A -1.2065
406 L A -1.3989
407 N A -1.9685
408 P A 0.0000
409 E A -3.2085
410 N A -2.5785
411 L A -2.0332
412 E A -2.6426
413 L A -1.5428
414 E A -2.2706
415 Q A -1.6811
416 T A -1.0806
417 W A -1.0522
418 E A -1.8730
419 T A 0.0000
420 N A -1.2285
421 I A 0.4840
422 R A -0.1439
423 K A 0.0000
424 Q A 0.0000
425 S A 0.2913
426 V A 0.0000
427 A A 0.0000
428 N A 0.0000
429 A A 0.0000
430 F A 0.0000
431 I A 0.0000
432 I A 0.0000
433 C A 0.4781
434 G A 0.0000
435 T A 0.0000
436 L A 0.0000
437 Y A 0.0000
438 T A 0.0000
439 V A 0.0000
440 S A -0.1598
441 S A 0.0000
442 Y A -0.0239
443 T A 0.0762
444 S A -0.3681
445 A A -1.0707
446 D A -2.5587
447 A A -1.4004
448 T A -0.8039
449 V A 0.0000
450 N A -0.7199
451 F A 0.0000
452 A A 0.0000
453 Y A 0.0000
454 D A -0.3121
455 T A 0.0000
456 G A -0.3818
457 T A 0.1556
458 G A 0.1734
459 I A 1.2454
460 S A -0.0456
461 K A -1.5653
462 T A -0.9835
463 L A -0.1485
464 T A 0.0064
465 I A 0.0000
466 P A -0.5575
467 F A 0.0000
468 K A -2.6472
469 N A 0.0000
470 R A -1.4516
471 Y A 0.4000
472 K A -0.3384
473 Y A 0.9150
474 S A 0.2518
475 S A 0.0000
476 M A 0.0000
477 I A 0.0000
478 D A 0.0000
479 Y A 0.0000
480 N A 0.0000
481 P A 0.0000
482 L A 0.6979
483 E A -1.0246
484 K A -2.5004
485 K A -2.0708
486 L A 0.0000
487 F A 0.0000
488 A A 0.0000
489 W A 0.0000
490 D A 0.0000
491 N A -0.8363
492 L A 0.0000
493 N A -0.5942
494 M A 0.0000
495 V A 0.0000
496 T A 0.0000
497 Y A 0.0000
498 D A -2.4141
499 I A 0.0000
500 K A -1.4619
501 L A -0.1517
502 S A 0.1098
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.3254 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_7 -0.3254 View CSV PDB
model_4 -0.4284 View CSV PDB
model_2 -0.4284 View CSV PDB
model_10 -0.4631 View CSV PDB
model_8 -0.4697 View CSV PDB
CABS_average -0.477 View CSV PDB
model_1 -0.4788 View CSV PDB
model_5 -0.4834 View CSV PDB
model_6 -0.5087 View CSV PDB
input -0.5117 View CSV PDB
model_9 -0.5178 View CSV PDB
model_0 -0.5241 View CSV PDB
model_3 -0.5375 View CSV PDB
model_11 -0.5584 View CSV PDB