Project name: b58b6cc572f82e9

Status: done

Started: 2026-04-14 06:36:53
Chain sequence(s) A: MHHHHHHENLYFQGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAAGERGAPGFRGPAGPNGIPGEKGPAGERGGGGSGGGGSGGGGSSGPSEGGSSSTMYVSGPPGPPGPPGPPGSISSSGQEIQQYISEYMQSDSIRSYLSGVQGPPGPPGPPGPVTTITGETFDYSELASHVVSYLRTSGYGVSLFSSSISSEDILAVLQRDDVRQYLRQYLM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:34)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b58b6cc572f82e9/tmp/folded.pdb                (00:02:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:11)
Show buried residues

Minimal score value
-3.7011
Maximal score value
2.6106
Average score
-0.9136
Total score value
-224.7471

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.2157
2 H A -1.3413
3 H A -2.0793
4 H A -2.4903
5 H A -2.8330
6 H A -3.0056
7 H A -2.8953
8 E A -2.7011
9 N A -1.1911
10 L A 1.3015
11 Y A 2.0118
12 F A 2.1457
13 Q A 0.1160
14 G A -0.3701
15 A A -0.5447
16 A A -1.1378
17 G A -1.8868
18 E A -3.0283
19 R A -3.0802
20 G A -1.9741
21 A A -0.8504
22 P A -0.6205
23 G A -0.1927
24 F A 0.6458
25 R A -1.2972
26 G A -1.0309
27 P A -0.7709
28 A A -0.9036
29 G A -1.0468
30 P A -1.0143
31 N A -1.3501
32 G A -0.3625
33 I A 1.2356
34 P A -0.4679
35 G A -1.4816
36 E A -3.0192
37 K A -3.0213
38 G A -1.9152
39 P A -0.9227
40 A A -1.1875
41 G A -1.8903
42 E A -3.0207
43 R A -3.0181
44 G A -1.8437
45 A A -0.6650
46 A A -1.2259
47 G A -1.8727
48 E A -3.2940
49 R A -3.7011
50 G A -2.2332
51 A A -1.3394
52 P A -0.7660
53 G A -0.2935
54 F A 0.4300
55 R A -1.3369
56 G A -1.1027
57 P A -0.8171
58 A A -0.9745
59 G A -1.2072
60 P A -1.0081
61 N A -1.2692
62 G A -0.3878
63 I A 1.2163
64 P A -0.4912
65 G A -1.6819
66 E A -3.0257
67 K A -2.9903
68 G A -1.9046
69 P A -0.9448
70 A A -1.2556
71 G A -1.8795
72 E A -3.0197
73 R A -3.0195
74 G A -1.8115
75 A A -0.6641
76 A A -1.1393
77 G A -2.3927
78 E A -3.4409
79 R A -3.3751
80 G A -2.2686
81 A A -0.7924
82 P A -0.6508
83 G A -0.2620
84 F A 0.6348
85 R A -1.1220
86 G A -1.1073
87 P A -0.8107
88 A A -0.8847
89 G A -1.0576
90 P A -0.9733
91 N A -1.2771
92 G A -0.3629
93 I A 0.9818
94 P A -0.5039
95 G A -1.5092
96 E A -2.8243
97 K A -3.0058
98 G A -1.9782
99 P A -1.4267
100 A A -1.3272
101 G A -1.9477
102 E A -3.1315
103 R A -3.2339
104 G A -2.2798
105 G A -1.7585
106 G A -1.3888
107 G A -1.1229
108 S A -0.9417
109 G A -1.0638
110 G A -1.1240
111 G A -1.0715
112 G A -1.0120
113 S A -0.8616
114 G A -1.0035
115 G A -1.0711
116 G A -1.0613
117 G A -0.9949
118 S A -0.7350
119 S A -0.7198
120 G A -1.0508
121 P A -1.1561
122 S A -1.5822
123 E A -2.4113
124 G A -1.7550
125 G A -1.3666
126 S A -0.9739
127 S A -0.4952
128 S A 0.0410
129 T A 0.8883
130 M A 2.0741
131 Y A 2.5108
132 V A 2.4633
133 S A 0.8698
134 G A -0.1893
135 P A -0.5686
136 P A -0.9390
137 G A -1.1288
138 P A -0.9944
139 P A -0.9623
140 G A -1.0704
141 P A -0.6795
142 P A -0.8840
143 G A -1.1633
144 P A -0.7045
145 P A -0.6012
146 G A -0.4223
147 S A 0.3215
148 I A 1.1862
149 S A 0.4533
150 S A -0.3707
151 S A -1.1588
152 G A -1.8559
153 Q A -2.6832
154 E A -2.4460
155 I A -0.8907
156 Q A -2.0973
157 Q A -2.2874
158 Y A -0.5644
159 I A 0.0740
160 S A -1.0289
161 E A -1.7607
162 Y A -0.6759
163 M A -0.6350
164 Q A -2.0856
165 S A -2.1797
166 D A -2.5104
167 S A -1.4201
168 I A 0.0000
169 R A -2.1640
170 S A -1.0503
171 Y A 0.0958
172 L A 0.2653
173 S A 0.0122
174 G A 0.2389
175 V A 1.1076
176 Q A -0.5856
177 G A -1.0339
178 P A -0.9753
179 P A -1.2228
180 G A -1.2497
181 P A -0.9364
182 P A -0.9167
183 G A -1.1822
184 P A -0.9026
185 P A -0.4724
186 G A -0.6025
187 P A 0.1628
188 V A 1.5317
189 T A 0.7484
190 T A 0.3955
191 I A 1.4614
192 T A 0.1236
193 G A -0.7573
194 E A -1.5848
195 T A -0.2603
196 F A 0.2326
197 D A -0.8083
198 Y A 0.4205
199 S A -0.5394
200 E A -1.3515
201 L A -0.0519
202 A A -0.0974
203 S A -0.3106
204 H A -0.3562
205 V A 0.0937
206 V A 0.3310
207 S A -0.4317
208 Y A -0.2439
209 L A 0.0000
210 R A -1.8055
211 T A -0.9928
212 S A -0.8317
213 G A -0.9975
214 Y A -0.5493
215 G A -0.6171
216 V A 0.5866
217 S A 1.1105
218 L A 2.5217
219 F A 2.6106
220 S A 1.2754
221 S A 0.4213
222 S A 0.3743
223 I A 1.1050
224 S A -0.0155
225 S A -0.2271
226 E A -1.2769
227 D A -0.7249
228 I A 0.8626
229 L A 0.7502
230 A A -0.2512
231 V A 0.0000
232 L A -0.5839
233 Q A -1.7115
234 R A -2.5605
235 D A -3.4249
236 D A -2.7473
237 V A 0.0000
238 R A -3.4065
239 Q A -3.0880
240 Y A -1.6078
241 L A -1.1049
242 R A -1.8323
243 Q A -1.2407
244 Y A 0.3712
245 L A 1.4395
246 M A 1.2064
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.0418 4.9197 View CSV PDB
4.5 -0.106 4.9197 View CSV PDB
5.0 -0.1861 4.9197 View CSV PDB
5.5 -0.2676 4.9197 View CSV PDB
6.0 -0.3362 4.9197 View CSV PDB
6.5 -0.3841 4.9196 View CSV PDB
7.0 -0.4131 4.9196 View CSV PDB
7.5 -0.4302 4.9196 View CSV PDB
8.0 -0.4403 4.9194 View CSV PDB
8.5 -0.4443 4.9187 View CSV PDB
9.0 -0.4422 4.9167 View CSV PDB