Project name: b591c20ebce052d

Status: done

Started: 2026-07-14 12:44:59
Chain sequence(s) A: QVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDDHYCLDYWGQGTPVTVSSGSTSGSGKPGSGEGSTKGDIQMTQSPSSLSASVGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQIT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:52)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b591c20ebce052d/tmp/folded.pdb                (00:01:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:08)
Show buried residues

Minimal score value
-3.458
Maximal score value
1.2369
Average score
-0.7716
Total score value
-187.5005

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4391
2 V A -0.7759
3 Q A -1.1805
4 L A 0.0000
5 V A -0.0860
6 Q A 0.0000
7 S A -0.7892
8 G A -0.9686
9 G A -0.4518
10 G A 0.2415
11 V A 1.2369
12 V A 0.0000
13 Q A -1.9021
14 P A -2.0685
15 G A -2.1048
16 R A -2.8094
17 S A -2.1674
18 L A -1.3560
19 R A -1.9171
20 L A 0.0000
21 S A -0.7772
22 C A 0.0000
23 K A -1.7394
24 A A 0.0000
25 S A -1.1999
26 G A -0.9684
27 Y A -0.6652
28 T A -0.6972
29 F A 0.0000
30 T A -1.5346
31 R A -1.9563
32 Y A -0.9635
33 T A -0.5653
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.7509
40 A A -1.1895
41 P A -1.1556
42 G A -1.4504
43 K A -2.3693
44 G A -1.6047
45 L A 0.0000
46 E A -0.9017
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 Y A 0.1295
51 I A 0.0000
52 N A -0.8295
53 P A 0.0000
54 S A -1.4808
55 R A -1.6100
56 G A -0.7711
57 Y A 0.3968
58 T A -0.0416
59 N A -1.0202
60 Y A -1.6159
61 N A -1.9701
62 Q A -2.9016
63 K A -2.5470
64 V A 0.0000
65 K A -3.4580
66 D A -3.2753
67 R A -2.4217
68 F A 0.0000
69 T A -1.1906
70 I A 0.0000
71 S A -0.5137
72 R A -1.8498
73 D A -2.1867
74 N A -2.0805
75 S A -1.8064
76 K A -2.8634
77 N A -2.4220
78 T A 0.0000
79 A A 0.0000
80 F A -0.7598
81 L A 0.0000
82 Q A -1.1793
83 M A 0.0000
84 D A -2.2902
85 S A -1.9931
86 L A 0.0000
87 R A -2.4806
88 P A -1.9159
89 E A -2.4747
90 D A 0.0000
91 T A -0.6719
92 G A 0.0000
93 V A 0.1952
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 Y A -0.3237
100 Y A -1.0639
101 D A -2.4508
102 D A -2.4475
103 H A -1.3993
104 Y A -0.3903
105 C A 0.0000
106 L A 0.0000
107 D A -0.1995
108 Y A 0.1221
109 W A -0.4197
110 G A 0.0000
111 Q A -1.4386
112 G A -0.7806
113 T A 0.0000
114 P A -0.0888
115 V A 0.0000
116 T A -0.0299
117 V A 0.0000
118 S A -0.9199
119 S A -1.0561
120 G A -0.7920
121 S A -0.7034
122 T A -0.5616
123 S A -0.7196
124 G A -1.1052
125 S A -1.2092
126 G A -1.7015
127 K A -2.3193
128 P A -1.8521
129 G A -1.8711
130 S A -1.5420
131 G A -2.0113
132 E A -2.4095
133 G A -2.0598
134 S A -1.9438
135 T A -1.9481
136 K A -2.1335
137 G A -1.7036
138 D A -1.4580
139 I A 0.0000
140 Q A -0.8811
141 M A 0.0000
142 T A -0.7620
143 Q A 0.0000
144 S A -0.4848
145 P A -0.6405
146 S A -0.9234
147 S A -0.9609
148 L A -0.4448
149 S A -0.4559
150 A A -0.2899
151 S A -0.0913
152 V A 0.5178
153 G A -0.7787
154 D A -1.6233
155 R A -2.2918
156 V A 0.0000
157 T A -0.6064
158 I A 0.0000
159 T A -0.5693
160 C A 0.0000
161 S A -1.1005
162 A A 0.0000
163 S A -0.8865
164 S A -0.7999
165 S A -0.6864
166 V A 0.0000
167 S A -0.0440
168 Y A 0.5149
169 M A 0.0000
170 N A 0.0000
171 W A 0.0000
172 Y A 0.0000
173 Q A 0.0000
174 Q A 0.0000
175 T A -1.2906
176 P A -0.9619
177 G A -1.5602
178 K A -2.5029
179 A A -1.6017
180 P A 0.0000
181 K A -1.8714
182 R A -0.7991
183 W A -0.5838
184 I A 0.0000
185 Y A -0.0613
186 D A 0.0000
187 T A 0.0000
188 S A -0.6992
189 K A -1.0938
190 L A -0.2681
191 A A 0.0000
192 S A -0.4232
193 G A -0.4366
194 V A -0.2470
195 P A -0.2676
196 S A -0.3653
197 R A -0.7435
198 F A 0.0000
199 S A -0.5115
200 G A -0.5149
201 S A -0.8452
202 G A -1.0804
203 S A -0.9572
204 G A -0.9228
205 T A -1.2193
206 D A -2.1487
207 Y A 0.0000
208 T A -0.7052
209 F A 0.0000
210 T A -0.5927
211 I A 0.0000
212 S A -1.3022
213 S A -1.1280
214 L A 0.0000
215 Q A -0.7841
216 P A -0.9130
217 E A -1.9378
218 D A 0.0000
219 I A -0.6707
220 A A 0.0000
221 T A -0.8119
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 Q A 0.0000
226 Q A 0.0000
227 W A 0.2153
228 S A -0.0678
229 S A -0.5398
230 N A -1.0915
231 P A -0.9345
232 F A -0.2556
233 T A -0.4647
234 F A 0.0000
235 G A 0.0000
236 Q A -1.7134
237 G A 0.0000
238 T A 0.0000
239 K A -1.7196
240 L A 0.0000
241 Q A -0.6060
242 I A 0.4093
243 T A 0.2374
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8783 2.0245 View CSV PDB
4.5 -0.9141 2.0245 View CSV PDB
5.0 -0.9528 2.0245 View CSV PDB
5.5 -0.9869 2.0245 View CSV PDB
6.0 -1.0084 2.0245 View CSV PDB
6.5 -1.0126 2.0245 View CSV PDB
7.0 -1.0018 2.0245 View CSV PDB
7.5 -0.982 2.0245 View CSV PDB
8.0 -0.9568 2.0245 View CSV PDB
8.5 -0.9259 2.0245 View CSV PDB
9.0 -0.8879 2.0245 View CSV PDB