Project name: b597854f44af08f

Status: done

Started: 2026-06-06 04:26:41
Chain sequence(s) A: GELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGKDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:29)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b597854f44af08f/tmp/folded.pdb                (00:03:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:47)
Show buried residues

Minimal score value
-3.4896
Maximal score value
1.3899
Average score
-0.6444
Total score value
-166.2575

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
246 G A -1.8438
247 E A -2.1293
248 L A 0.0000
249 V A 0.6972
250 W A 0.2040
251 V A 0.0000
252 G A -1.6700
253 E A -2.3083
254 P A -0.9711
255 L A 0.6205
256 T A 0.3583
257 L A 0.4281
258 R A -0.3521
259 T A -0.7406
260 A A 0.0000
261 E A -1.5509
262 T A -0.0501
263 I A 1.3899
264 T A 0.4927
265 G A 0.0000
266 K A -0.1357
267 Y A 0.2437
268 G A 0.0000
269 V A 0.0000
270 W A 0.0000
271 M A 0.0000
272 R A -0.8194
273 D A 0.0000
274 P A 0.0000
275 K A -1.6493
276 P A -0.9568
277 T A -0.1411
278 Y A 1.0126
279 P A 0.2929
280 Y A 0.0000
281 T A -0.9786
282 Q A -1.8699
283 E A -1.3528
284 T A 0.0000
285 T A 0.0000
286 W A 0.0000
287 R A 0.0000
288 I A 0.0000
289 D A -0.2091
290 T A 0.0000
291 V A -0.2608
292 G A -1.4673
293 K A -2.9010
294 D A -2.9682
295 V A 0.0000
296 R A -1.2480
297 Q A -0.6476
298 V A 0.0000
299 F A 0.3936
300 E A 0.0000
301 Y A 0.0000
302 D A -1.0425
303 L A 0.1814
304 I A 0.0145
305 S A -0.0739
306 Q A -0.0826
307 F A 0.0000
308 M A 0.0964
309 Q A -0.8080
310 G A -0.3080
311 Y A 0.6451
312 P A 0.1040
313 S A -0.4280
314 K A -0.6181
315 V A 0.6319
316 H A 0.0000
317 I A 1.1374
318 L A 0.0000
319 P A -0.5282
320 R A -1.0503
321 P A -1.7232
322 L A 0.0000
323 E A -1.1946
324 S A -0.3647
325 T A 0.0000
326 G A -0.1125
327 A A 0.0000
328 V A 0.0000
329 V A 0.0000
330 Y A 0.0000
331 S A -0.7262
332 G A 0.0000
333 S A 0.0000
334 L A 0.0000
335 Y A 0.0000
336 F A 0.0000
337 Q A 0.0000
338 G A 0.0000
339 A A -1.6802
340 E A -2.1402
341 S A -1.5522
342 R A -1.8122
343 T A -2.0182
344 V A 0.0000
345 I A 0.0000
346 R A -1.6715
347 Y A 0.0000
348 E A -1.4017
349 L A 0.0000
350 N A -1.6745
351 T A -1.6102
352 E A -1.8970
353 T A -1.3225
354 V A -1.1562
355 K A -2.6276
356 A A -2.6244
357 E A -3.0590
358 K A -2.7660
359 E A -2.9149
360 I A 0.0000
361 P A -1.0420
362 G A -1.4931
363 A A 0.0000
364 G A 0.0000
365 Y A -0.7372
366 H A -1.0605
367 G A -0.9329
368 Q A -1.3898
369 F A -1.1656
370 P A -0.6002
371 Y A 0.0000
372 S A -0.5591
373 W A 0.0034
374 G A -0.3063
375 G A 0.0007
376 Y A -0.0111
377 T A 0.0000
378 D A 0.0000
379 I A 0.0000
380 D A -0.1560
381 L A 0.0000
382 A A 0.0000
383 V A 0.0000
384 D A 0.0000
385 E A -0.9630
386 A A -0.4486
387 G A 0.0000
388 L A 0.0000
389 W A 0.0000
390 V A 0.0000
391 I A 0.0000
392 Y A 0.0000
393 S A 0.0000
394 T A 0.0000
395 D A -3.4863
396 E A -3.4896
397 A A -3.0764
398 K A -3.3304
399 G A 0.0000
400 A A -2.5178
401 I A 0.0000
402 V A 0.0000
403 L A 0.0000
404 S A 0.0000
405 K A -1.4345
406 L A 0.0000
407 N A -2.0571
408 P A -1.6260
409 E A -3.0336
410 N A -3.2581
411 L A 0.0000
412 E A -2.9841
413 L A -1.8164
414 E A -2.4923
415 Q A -2.1205
416 T A -1.2718
417 W A -1.1524
418 E A -2.2338
419 T A -1.5338
420 N A -2.1435
421 I A -1.5565
422 R A -2.3789
423 K A 0.0000
424 Q A -1.3762
425 S A -1.0296
426 V A 0.0000
427 A A 0.0000
428 N A 0.0000
429 A A 0.0000
430 F A 0.0000
431 I A 0.0000
432 I A 0.0000
433 C A -0.5027
434 G A -0.6030
435 T A -0.4346
436 L A 0.0000
437 Y A 0.0000
438 T A 0.0000
439 V A 0.0000
440 S A -0.4377
441 S A -0.5701
442 Y A -0.3590
443 T A -1.1985
444 S A -1.3373
445 A A -1.7460
446 D A -2.0451
447 A A 0.0000
448 T A -0.7770
449 V A 0.0000
450 N A -0.5440
451 F A 0.0000
452 A A 0.0000
453 Y A 0.0000
454 D A -0.5740
455 T A -0.5393
456 G A -0.4300
457 T A 0.0092
458 G A 0.0294
459 I A 1.1929
460 S A -0.2241
461 K A -1.1611
462 T A -0.8054
463 L A -0.2085
464 T A 0.0722
465 I A 0.0000
466 P A -0.8174
467 F A 0.0000
468 K A -2.4127
469 N A 0.0000
470 R A -2.5302
471 Y A -1.4489
472 K A -2.1318
473 Y A -0.8162
474 S A 0.0000
475 S A 0.0000
476 M A 0.0000
477 I A 0.0000
478 D A -0.3210
479 Y A 0.0000
480 N A 0.0000
481 P A -0.8297
482 L A -0.6432
483 E A -1.1580
484 K A -2.0034
485 K A -1.9244
486 L A 0.0000
487 F A 0.0000
488 A A 0.0000
489 W A 0.0000
490 D A 0.0000
491 N A -0.5625
492 L A -0.0260
493 N A 0.0000
494 M A 0.0000
495 V A 0.0000
496 T A 0.0000
497 Y A 0.0000
498 D A -2.5799
499 I A 0.0000
500 K A -2.0829
501 L A -1.3745
502 S A -1.5140
503 K A -2.3593
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4918 2.2841 View CSV PDB
4.5 -0.5486 2.2399 View CSV PDB
5.0 -0.6227 2.1966 View CSV PDB
5.5 -0.6991 2.1436 View CSV PDB
6.0 -0.7603 2.0935 View CSV PDB
6.5 -0.7923 2.06 View CSV PDB
7.0 -0.7925 2.0529 View CSV PDB
7.5 -0.7696 2.0708 View CSV PDB
8.0 -0.7343 2.1193 View CSV PDB
8.5 -0.6925 2.2002 View CSV PDB
9.0 -0.6461 2.2838 View CSV PDB