Project name: b627dcda87d6ebf

Status: done

Started: 2026-02-20 16:43:32
Chain sequence(s) B: EVQLLESGGGLVQPGGSLRLSCAASGFTFAQSLLNQWVRQAPGKGLEWVSGIQGAAGAVTYTRPGSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQAITSSGKIVHAWGQGTLVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRSGLHTFGQGTKLEIK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:16)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b627dcda87d6ebf/tmp/folded.pdb                (00:03:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:48)
Show buried residues

Minimal score value
-2.6094
Maximal score value
1.4231
Average score
-0.5111
Total score value
-116.5309

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E B -2.1222
2 V B -1.3257
3 Q B -1.2309
4 L B 0.0000
5 L B 0.5933
6 E B -0.1317
7 S B -0.6456
8 G B -1.1180
9 G B -0.2945
10 G B 0.4483
11 L B 1.4231
12 V B 0.3128
13 Q B -0.9395
14 P B -1.1219
15 G B -1.1577
16 G B -0.8454
17 S B -1.1428
18 L B -1.1054
19 R B -2.1922
20 L B 0.0000
21 S B -0.5257
22 C B 0.0000
23 A B -0.2139
24 A B 0.0000
25 S B -0.6855
26 G B -1.1066
27 F B -0.5572
28 T B -0.5827
29 F B 0.0000
30 A B -0.2416
31 Q B -0.2234
32 S B 0.0000
33 L B 0.5476
34 L B 0.0000
35 N B 0.0000
36 Q B 0.0000
37 W B 0.0000
38 V B 0.0000
39 R B 0.0000
40 Q B 0.0000
41 A B 0.0000
42 P B -0.8022
43 G B -1.3278
44 K B -2.1471
45 G B -1.3730
46 L B 0.0000
47 E B 0.0000
48 W B 0.0000
49 V B 0.0000
50 S B 0.0000
51 G B 0.0000
52 I B 0.0000
53 Q B 0.1570
54 G B 0.1170
55 A B 0.1487
56 A B -0.0415
57 G B -0.0973
58 A B 0.4004
59 V B 0.9488
60 T B 0.3816
61 Y B 0.3366
62 T B -0.3006
63 R B -0.5707
64 P B -0.6859
65 G B -0.9189
66 S B -1.0452
67 R B -1.5634
68 F B 0.0000
69 T B -0.7117
70 I B 0.0000
71 S B -0.5607
72 R B -1.2174
73 D B -1.9975
74 N B -2.3496
75 S B -1.9418
76 K B -2.5238
77 N B -1.7883
78 T B 0.0000
79 L B 0.0000
80 Y B -0.5327
81 L B 0.0000
82 Q B -1.3146
83 M B 0.0000
84 N B -1.6306
85 S B -1.2253
86 L B 0.0000
87 R B -1.3901
88 A B -1.0395
89 E B -1.2715
90 D B 0.0000
91 T B 0.0000
92 A B 0.0000
93 V B 0.3291
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 A B 0.0000
98 R B 0.0000
99 Q B 0.0990
100 A B 0.0000
101 I B -0.1767
102 T B -0.9050
103 S B -0.7142
104 S B -0.9765
105 G B -1.2783
106 K B -1.6743
107 I B -0.2952
108 V B 0.0000
109 H B -0.4360
110 A B -0.7348
111 W B -0.6631
112 G B 0.0000
113 Q B -1.5616
114 G B -0.6274
115 T B -0.1185
116 L B 0.9329
117 V B 0.0000
118 T B 0.3031
119 V B -0.3826
120 S B -0.7049
121 S B -0.9315
137 D B -1.0811
138 I B -0.0364
139 Q B -1.0090
140 M B -0.5421
141 T B -0.8885
142 Q B 0.0000
143 S B -0.7118
144 P B -0.5963
145 S B -0.7852
146 S B -1.1673
147 L B -0.7531
148 S B -0.9447
149 A B 0.0000
150 S B -0.1497
151 V B 0.6674
152 G B -0.6064
153 D B -1.6493
154 R B -2.2306
155 V B 0.0000
156 T B -0.5841
157 I B 0.0000
158 T B -0.8245
159 C B 0.0000
160 R B -2.5848
161 A B 0.0000
162 S B -1.3968
163 Q B -2.0310
164 S B -1.4820
165 I B 0.0000
166 S B -0.6687
167 S B -0.2028
168 Y B 0.4212
169 L B 0.0000
170 N B 0.0000
171 W B 0.0000
172 Y B 0.0000
173 Q B 0.0000
174 Q B -1.3591
175 K B -1.7393
176 P B -1.4163
177 G B -1.6937
178 K B -2.6094
179 A B -1.7007
180 P B 0.0000
181 K B -1.4584
182 L B 0.0000
183 L B 0.0000
184 I B 0.0000
185 Y B 0.4943
186 A B 0.2443
187 A B 0.0000
188 S B -0.1254
189 S B 0.0863
190 L B 0.3218
191 Q B 0.0000
192 S B -0.5789
193 G B -0.8152
194 V B 0.0000
195 P B -0.3729
196 S B -0.4181
197 R B -0.7182
198 F B 0.0000
199 S B -0.3486
200 G B -0.3249
201 S B -0.6764
202 G B -0.9113
203 S B -0.8978
204 G B -1.0849
205 T B -1.7033
206 D B -2.2434
207 F B 0.0000
208 T B -0.7595
209 L B 0.0000
210 T B -0.6165
211 I B 0.0000
212 S B -1.2351
213 S B -1.0541
214 L B 0.0000
215 Q B -1.0195
216 P B -0.6074
217 E B -1.9137
218 D B 0.0000
219 F B -0.6529
220 A B 0.0000
221 T B 0.0000
222 Y B 0.0000
223 Y B 0.0000
224 C B 0.0000
225 Q B 0.0000
226 Q B 0.0000
227 S B -0.5101
228 R B -1.6530
229 S B -0.8993
230 G B -0.3319
231 L B -0.0871
232 H B 0.0000
233 T B -0.2171
234 F B 0.0000
235 G B 0.0000
236 Q B -1.1327
237 G B 0.0000
238 T B 0.0000
239 K B -1.6584
240 L B 0.0000
241 E B -1.2862
242 I B 0.5680
243 K B -0.9972
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5886 2.076 View CSV PDB
4.5 -0.6103 2.076 View CSV PDB
5.0 -0.6356 2.076 View CSV PDB
5.5 -0.6589 2.076 View CSV PDB
6.0 -0.6736 2.076 View CSV PDB
6.5 -0.6747 2.076 View CSV PDB
7.0 -0.6618 2.076 View CSV PDB
7.5 -0.6393 2.076 View CSV PDB
8.0 -0.6115 2.076 View CSV PDB
8.5 -0.5801 2.076 View CSV PDB
9.0 -0.5458 2.076 View CSV PDB