Project name: b71e79b14cc3ea9

Status: done

Started: 2026-03-27 08:20:52
Chain sequence(s) A: EVQLVESGGGLVKPGGSLKVSCAASGFSLSDYVLSWVRQTPEKRLEWVATINYDGDITYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARLDLGRKSDYAFDLWGAGTTVTVSS
B: DIVMTQSHKFMSTSVGDRVSITCRASQSISSYLHWYQEKPGQCPKLLIYGTSNRETGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQSTIETLTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:38)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/b71e79b14cc3ea9/tmp/folded.pdb                (00:02:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:06)
Show buried residues

Minimal score value
-2.9391
Maximal score value
1.5422
Average score
-0.7073
Total score value
-161.9642

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8535
2 V A -0.7420
3 Q A -0.5268
4 L A 0.0000
5 V A 1.5422
6 E A 0.0000
7 S A -0.1801
8 G A -0.8626
9 G A -0.3576
10 G A 0.2881
11 L A 1.0887
12 V A -0.3646
13 K A -1.9116
14 P A -1.9653
15 G A -1.5801
16 G A -1.0643
17 S A -1.1456
18 L A -0.7907
19 K A -1.6678
20 V A 0.0000
21 S A -0.2848
22 C A 0.0000
23 A A 0.0950
24 A A 0.0000
25 S A -0.5786
26 G A -1.0005
27 F A -0.6429
28 S A -0.9748
29 L A 0.0000
30 S A -1.4336
31 D A -1.9014
32 Y A -0.7849
33 V A 0.0000
34 L A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.9955
40 T A -1.6348
41 P A -1.7547
42 E A -2.6883
43 K A -2.4129
44 R A -1.9624
45 L A 0.0000
46 E A -0.7345
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.0000
51 I A 0.0000
52 N A -0.5546
53 Y A -0.9629
54 D A -2.2818
55 G A -1.5399
56 D A -1.7092
57 I A 0.2277
58 T A 0.1587
59 Y A -0.0672
60 Y A -0.9964
61 P A -1.7926
62 D A -2.7011
63 S A -1.7861
64 V A 0.0000
65 K A -2.6234
66 G A -1.7573
67 R A -1.4943
68 F A 0.0000
69 T A -0.8075
70 I A 0.0000
71 S A -0.7368
72 R A -1.2643
73 D A -1.5666
74 N A -1.8795
75 A A -1.2592
76 K A -2.1177
77 N A -1.4462
78 T A -0.7993
79 L A 0.0000
80 Y A -0.4691
81 L A 0.0000
82 Q A -1.2486
83 M A 0.0000
84 S A -1.0804
85 S A -1.2322
86 L A 0.0000
87 R A -2.9391
88 S A -2.2755
89 E A -2.5328
90 D A 0.0000
91 T A -0.8262
92 A A 0.0000
93 M A 0.0569
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.1552
99 L A 0.0000
100 D A -0.6795
101 L A -0.4947
102 G A -1.4491
103 R A -2.3160
104 K A -1.8587
105 S A 0.0000
106 D A -0.8260
107 Y A 0.2353
108 A A 0.0000
109 F A 0.0000
110 D A -0.7461
111 L A -0.4350
112 W A 0.0000
113 G A 0.0000
114 A A 0.2038
115 G A 0.2339
116 T A 0.0667
117 T A 0.0886
118 V A 0.0000
119 T A -0.2147
120 V A 0.0000
121 S A -0.9496
122 S A -0.9069
1 D B -1.7573
2 I B 0.0000
3 V B 0.7142
4 M B 0.0000
5 T B -0.8594
6 Q B -1.3418
7 S B -1.2050
8 H B -1.3755
9 K B -1.5265
10 F B 0.3375
11 M B -0.2638
12 S B -0.5218
13 T B 0.0000
14 S B -1.1013
15 V B -0.3608
16 G B -1.6640
17 D B -2.6279
18 R B -2.8642
19 V B 0.0000
20 S B -0.4964
21 I B 0.0000
22 T B -0.9101
23 C B 0.0000
24 R B -2.0743
25 A B 0.0000
26 S B -0.8774
27 Q B -1.4737
28 S B -1.1681
29 I B 0.0000
30 S B -0.4204
31 S B -0.2394
32 Y B 0.4606
33 L B 0.0000
34 H B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 E B 0.0000
39 K B -1.3447
40 P B -0.8632
41 G B -1.0304
42 Q B -1.3630
43 C B -0.8139
44 P B 0.0000
45 K B -1.7204
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B -0.5471
50 G B 0.0000
51 T B 0.0000
52 S B -0.8648
53 N B -1.4848
54 R B -1.8373
55 E B -1.3320
56 T B -0.7266
57 G B -0.8528
58 V B -1.0954
59 P B -1.2509
60 D B -2.1506
61 R B -1.8126
62 L B 0.0000
63 T B -0.9251
64 G B 0.0000
65 S B -0.6959
66 G B -1.0444
67 S B -0.9381
68 G B -1.0748
69 T B -1.5886
70 D B -1.8965
71 F B 0.0000
72 T B -0.6688
73 L B 0.0000
74 T B -0.6702
75 I B 0.0000
76 S B -2.2045
77 N B -2.5176
78 V B 0.0000
79 E B -1.7674
80 S B -1.1884
81 E B -1.9827
82 D B 0.0000
83 L B -0.7736
84 A B 0.0000
85 D B -0.7651
86 Y B 0.0000
87 F B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 S B 0.0000
92 T B 0.0299
93 I B -0.4394
94 E B -1.6144
95 T B -1.1938
96 L B 0.0000
97 T B -0.2080
98 F B 0.0000
99 G B 0.0000
100 G B -1.4973
101 G B -1.3481
102 T B 0.0000
103 K B -0.7854
104 L B 0.0000
105 E B -1.0142
106 I B -0.6162
107 K B -1.5774
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7479 1.9843 View CSV PDB
4.5 -0.8072 1.7533 View CSV PDB
5.0 -0.8768 1.4917 View CSV PDB
5.5 -0.9443 1.335 View CSV PDB
6.0 -0.9972 1.3613 View CSV PDB
6.5 -1.0277 1.4072 View CSV PDB
7.0 -1.0379 1.4572 View CSV PDB
7.5 -1.0355 1.5591 View CSV PDB
8.0 -1.0256 1.8683 View CSV PDB
8.5 -1.0082 2.1723 View CSV PDB
9.0 -0.9813 2.4732 View CSV PDB