Project name: CagA_RD1

Status: done

Started: 2026-07-15 09:35:30
Chain sequence(s) A: MTDFVPQRFINNLQVAFIKVDNAVASFDPDQKPIVDKNDRDNRQAFEKISQLREEYANKAIKNPAKKDQYFSDFINKSNDLINKDNLIAVDSSVESFRKFGDQRYQIFTSWVSLQKDPSKINTQQIQNFMENIIQPPISDDKEKAEFLRSAKQSFAGIIIGNQIRSDEKFMGVFDESLKARQEAEKNAEPAGGDWLDIFLSFVFNKKQSSDLKETLNQETGTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:11:48)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ba2d83755fed974/tmp/folded.pdb                (00:11:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:16:02)
Show buried residues

Minimal score value
-4.0251
Maximal score value
1.9141
Average score
-1.4
Total score value
-319.1935

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.7139
2 T A -0.7773
3 D A -1.2932
4 F A -0.6319
5 V A -0.9222
6 P A -1.1499
7 Q A -1.9043
8 R A -2.2708
9 F A 0.0000
10 I A -0.8540
11 N A -1.8896
12 N A 0.0000
13 L A 0.0000
14 Q A -0.2320
15 V A -0.1005
16 A A 0.0000
17 F A 0.0000
18 I A 1.3091
19 K A -0.3857
20 V A 0.0000
21 D A -1.4706
22 N A -1.8795
23 A A 0.0000
24 V A 0.0000
25 A A -1.6351
26 S A -1.0862
27 F A -1.4468
28 D A 0.0000
29 P A -1.7811
30 D A -2.4779
31 Q A 0.0000
32 K A -2.9010
33 P A -1.9070
34 I A -1.0669
35 V A 0.0000
36 D A -2.6261
37 K A -2.9063
38 N A 0.0000
39 D A -2.4272
40 R A -3.7349
41 D A -3.3827
42 N A 0.0000
43 R A -3.5137
44 Q A -3.2672
45 A A 0.0000
46 F A -2.0986
47 E A -3.2889
48 K A -2.7147
49 I A 0.0000
50 S A -2.2132
51 Q A -2.9136
52 L A -2.5092
53 R A -2.7153
54 E A -3.5413
55 E A -3.2477
56 Y A 0.0000
57 A A 0.0000
58 N A -2.4032
59 K A -3.0949
60 A A 0.0000
61 I A -0.9675
62 K A -2.2028
63 N A -1.9441
64 P A -1.4627
65 A A -1.4180
66 K A -2.6445
67 K A -2.7094
68 D A -2.8703
69 Q A -2.5158
70 Y A -2.1701
71 F A -1.5126
72 S A -1.6406
73 D A -1.9801
74 F A 0.0000
75 I A 0.0000
76 N A -2.8121
77 K A -3.0870
78 S A 0.0000
79 N A -2.8963
80 D A -3.5779
81 L A 0.0000
82 I A 0.0000
83 N A -2.9337
84 K A -3.1582
85 D A -2.7215
86 N A -2.1026
87 L A 0.0000
88 I A 0.0000
89 A A -1.1222
90 V A -0.7963
91 D A -1.8501
92 S A -1.3085
93 S A -0.7677
94 V A -0.8448
95 E A -2.4282
96 S A -1.7202
97 F A -1.2176
98 R A -2.6331
99 K A -2.2630
100 F A 0.0000
101 G A -1.6781
102 D A -2.2599
103 Q A -1.4851
104 R A -0.9175
105 Y A -0.6970
106 Q A -1.1637
107 I A -0.7000
108 F A 0.0000
109 T A 0.0000
110 S A 0.0000
111 W A 0.0000
112 V A 0.0000
113 S A 0.0000
114 L A -0.6367
115 Q A 0.0000
116 K A -1.7490
117 D A -1.9432
118 P A -1.7978
119 S A -1.4970
120 K A -2.3874
121 I A 0.0000
122 N A -1.7404
123 T A -1.6222
124 Q A -2.0561
125 Q A -1.6958
126 I A 0.0000
127 Q A -1.5645
128 N A -1.8265
129 F A 0.0000
130 M A 0.0000
131 E A -2.9446
132 N A -2.0487
133 I A 0.0000
134 I A 0.0000
135 Q A -2.1567
136 P A -1.1775
137 P A -0.6903
138 I A -0.1817
139 S A -1.6094
140 D A -2.7847
141 D A -3.1169
142 K A -2.8584
143 E A -2.0236
144 K A 0.0000
145 A A 0.0000
146 E A -1.4366
147 F A 0.0000
148 L A 0.0000
149 R A -0.7558
150 S A -0.1328
151 A A 0.0000
152 K A 0.0000
153 Q A 0.0000
154 S A 0.0000
155 F A 0.0000
156 A A 0.0000
157 G A 0.0000
158 I A 0.6490
159 I A 0.0000
160 I A 0.0000
161 G A 0.0000
162 N A -0.6770
163 Q A -1.1200
164 I A 0.0000
165 R A -1.6857
166 S A -1.7840
167 D A -2.5631
168 E A -3.2349
169 K A -2.8923
170 F A 0.0000
171 M A -2.2325
172 G A -2.1204
173 V A -1.2121
174 F A 0.0000
175 D A -2.8313
176 E A -3.1057
177 S A -2.3973
178 L A -2.1302
179 K A -3.3458
180 A A -2.4810
181 R A -2.7796
182 Q A -3.1778
183 E A -3.3510
184 A A -3.2017
185 E A -4.0251
186 K A -3.6879
187 N A -3.3535
188 A A -2.8187
189 E A -3.0689
190 P A -2.3984
191 A A -1.2698
192 G A -1.1878
193 G A -0.9924
194 D A 0.0000
195 W A -0.5302
196 L A 0.0000
197 D A -0.4668
198 I A 0.5618
199 F A 0.0000
200 L A 0.4611
201 S A 1.0310
202 F A 1.7331
203 V A 1.9141
204 F A -0.0784
205 N A -1.3363
206 K A -2.7719
207 K A -3.3797
208 Q A -2.6742
209 S A 0.0000
210 S A -3.0009
211 D A -3.5787
212 L A 0.0000
213 K A -2.9125
214 E A -3.6850
215 T A -2.4402
216 L A 0.0000
217 N A -3.2998
218 Q A -2.9921
219 E A -2.6117
220 T A -2.3466
221 G A -1.9583
222 T A -1.5644
223 H A -2.1147
224 H A -2.4172
225 H A -2.4138
226 H A -1.7697
227 H A -1.1263
228 H A -1.2662
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.2654 2.5022 View CSV PDB
4.5 -1.3599 2.496 View CSV PDB
5.0 -1.4762 2.4877 View CSV PDB
5.5 -1.5918 2.4783 View CSV PDB
6.0 -1.6816 2.4686 View CSV PDB
6.5 -1.7285 2.4587 View CSV PDB
7.0 -1.7314 2.4488 View CSV PDB
7.5 -1.7028 2.4389 View CSV PDB
8.0 -1.6559 2.4291 View CSV PDB
8.5 -1.5947 2.4199 View CSV PDB
9.0 -1.5169 2.416 View CSV PDB