Project name: new 12

Status: done

Started: 2026-03-17 06:32:47
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSAISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:10)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:11)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:11)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:12)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ba730042c2d50fa/tmp/folded.pdb                (00:03:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:21)
Show buried residues

Minimal score value
-2.9955
Maximal score value
1.4281
Average score
-0.7238
Total score value
-178.776

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8053
2 I A 0.0000
3 V A 0.7436
4 L A 0.0000
5 T A -0.6979
6 K A -0.9121
7 S A -0.7423
8 P A -0.3503
9 A A -0.2453
10 T A -0.2963
11 L A -0.3395
12 S A -0.7525
13 L A -1.2066
14 S A -1.6891
15 P A -1.9095
16 G A -1.7109
17 E A -2.2417
18 R A -2.6138
19 A A 0.0000
20 T A -0.6607
21 L A 0.0000
22 S A -1.0288
23 C A 0.0000
24 R A -2.5436
25 V A 0.0000
26 S A -1.2344
27 Q A -2.5229
28 N A -2.7455
29 V A 0.0000
30 S A -1.4591
31 S A -1.0936
32 N A -1.4189
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A -0.4538
38 Q A 0.0000
39 K A -1.1217
40 P A -0.8152
41 G A -1.2620
42 Q A -1.6533
43 A A -1.1600
44 P A 0.0000
45 R A -1.0466
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A -1.0993
51 T A 0.0000
52 S A -1.2918
53 N A -1.7934
54 R A -1.8247
55 A A 0.0000
56 T A -0.7377
57 G A -0.8410
58 I A 0.0000
59 P A -0.5053
60 A A -0.4181
61 R A -0.7046
62 F A 0.0000
63 S A -0.7876
64 G A -0.8465
65 S A -0.8628
66 G A -1.1151
67 S A -1.3024
68 G A -1.6442
69 T A -2.0632
70 D A -2.2785
71 F A 0.0000
72 T A -0.8424
73 L A 0.0000
74 T A -0.6185
75 I A 0.0000
76 S A -1.3265
77 S A -1.6342
78 L A 0.0000
79 E A -1.9761
80 P A -1.6744
81 E A -2.3533
82 D A 0.0000
83 F A -0.6461
84 A A 0.0000
85 V A -0.1318
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A -1.4501
92 R A -2.7915
93 N A -2.3440
94 W A -0.8483
95 P A -0.9561
96 L A 0.0000
97 T A 0.0000
98 F A 0.1827
99 G A 0.0000
100 G A -0.8248
101 G A -0.7408
102 T A 0.0000
103 K A -0.4722
104 V A 0.0000
105 E A -1.1489
106 I A -1.7121
107 K A -2.2351
108 G A -1.7612
109 G A -1.6558
110 G A -1.3977
111 G A -1.1722
112 S A -1.3586
113 G A -1.4808
114 G A -1.5610
115 G A -1.4173
116 G A -1.6708
117 S A -1.2438
118 G A -1.2229
119 G A -1.2917
120 G A -1.4304
121 G A -1.7255
122 S A -1.7317
123 E A -2.4471
124 V A -1.5566
125 Q A -1.7176
126 L A 0.0000
127 V A 0.1144
128 E A 0.0000
129 S A -0.3582
130 G A -0.7133
131 G A 0.0863
132 G A 0.5877
133 L A 1.2908
134 V A 0.0000
135 Q A -1.5157
136 P A -1.9172
137 G A -1.6798
138 G A -1.1835
139 S A -1.4354
140 L A -0.9941
141 R A -1.9189
142 L A 0.0000
143 S A -0.4707
144 C A 0.0000
145 A A -0.4322
146 A A 0.0000
147 S A -1.1773
148 G A -1.2804
149 F A -0.9435
150 T A -0.7320
151 F A 0.0000
152 S A -1.6110
153 R A -1.9835
154 Y A 0.0000
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6965
162 A A -1.0929
163 P A -0.8750
164 G A -1.4899
165 K A -2.2836
166 G A -1.4093
167 L A 0.0000
168 E A -0.9047
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 A A 0.0000
173 I A 0.0000
174 S A -0.1987
175 A A -0.9071
176 S A -0.8065
177 G A -0.4489
178 A A -0.1356
179 T A -0.0253
180 T A 0.1862
181 Y A 0.1975
182 Y A -0.5544
183 A A 0.0000
184 D A -2.6220
185 P A -1.8578
186 V A 0.0000
187 K A -2.5908
188 G A -1.8515
189 R A -1.7535
190 F A 0.0000
191 T A -0.8560
192 I A 0.0000
193 S A -0.3921
194 R A -0.9385
195 D A -1.4810
196 N A -1.8483
197 S A -1.5620
198 K A -2.3859
199 N A -1.7808
200 T A -1.0894
201 L A 0.0000
202 Y A -0.4876
203 L A 0.0000
204 Q A -1.3049
205 M A 0.0000
206 N A -1.9222
207 S A -1.6083
208 L A 0.0000
209 R A -2.9955
210 A A -2.0548
211 E A -2.4683
212 D A 0.0000
213 T A -0.5623
214 A A 0.0000
215 V A 0.6434
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A 0.0000
222 Q A 0.0000
223 D A -1.1015
224 F A 0.1307
225 D A -0.7340
226 I A 0.9947
227 L A 0.7434
228 T A 0.5806
229 G A 0.6551
230 Y A 1.3981
231 L A 0.0000
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -0.6916
236 P A -0.8469
237 W A 0.0000
238 G A 0.0000
239 Q A -1.3913
240 G A 0.0000
241 T A 0.3771
242 L A 1.4281
243 V A 0.0000
244 T A 0.1566
245 V A 0.0000
246 S A -0.9179
247 S A -0.5819
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5866 3.3569 View CSV PDB
4.5 -0.6223 3.1292 View CSV PDB
5.0 -0.6645 2.8661 View CSV PDB
5.5 -0.7066 2.5881 View CSV PDB
6.0 -0.7411 2.3054 View CSV PDB
6.5 -0.7622 2.0662 View CSV PDB
7.0 -0.7697 2.0662 View CSV PDB
7.5 -0.7675 2.0662 View CSV PDB
8.0 -0.7592 2.0662 View CSV PDB
8.5 -0.7461 2.0662 View CSV PDB
9.0 -0.7284 2.0662 View CSV PDB