Project name: ba7a95fa2957e43

Status: done

Started: 2026-06-05 10:06:39
Chain sequence(s) A: DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPFTFGSGTKLEIKGGGGSGGGGSGGGGSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCTRSWRGNSFDYWGQGTTLTVSS
B: DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/ba7a95fa2957e43/tmp/folded.pdb                (00:02:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:20)
Show buried residues

Minimal score value
-3.5043
Maximal score value
3.1713
Average score
-0.5822
Total score value
-174.0684

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.4940
2 I A -0.2366
3 V A 0.8895
4 M A 0.0000
5 T A -0.4197
6 Q A 0.0000
7 S A -0.6924
8 P A -0.5122
9 S A -0.5915
10 S A -0.6940
11 L A -0.3793
12 T A -0.7670
13 V A -1.1922
14 T A -1.6098
15 A A -1.7058
16 G A -1.6886
17 E A -2.4831
18 K A -2.5375
19 V A 0.0000
20 T A -0.6482
21 M A 0.0000
22 S A -0.9958
23 C A 0.0000
24 K A -2.1050
25 S A 0.0000
26 S A -0.9052
27 Q A -1.4714
28 S A -1.0088
29 L A 0.0000
30 L A -0.5994
31 N A -0.9834
32 S A -1.1578
33 G A -1.2550
34 N A -1.6250
35 Q A -2.0389
36 K A -1.6083
37 N A -0.7694
38 Y A 0.0000
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A 0.0000
44 Q A 0.0000
45 K A -1.1229
46 P A -0.7745
47 G A -1.1597
48 Q A -1.5800
49 P A -1.1878
50 P A 0.0000
51 K A -1.5331
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.4540
57 A A 0.0000
58 S A -0.6972
59 T A -0.6267
60 R A -1.4453
61 E A -1.0775
62 S A -0.7592
63 G A -0.9829
64 V A -1.0632
65 P A -1.2655
66 D A -2.1375
67 R A -1.4460
68 F A 0.0000
69 T A -0.7533
70 G A 0.0000
71 S A -0.7274
72 G A -1.3482
73 S A -1.3031
74 G A -1.1798
75 T A -1.7742
76 D A -2.5952
77 F A 0.0000
78 T A -0.8875
79 L A 0.0000
80 T A -0.5117
81 I A 0.0000
82 S A -1.5838
83 S A -1.8283
84 V A 0.0000
85 Q A -1.4217
86 A A -1.6450
87 E A -1.8136
88 D A 0.0000
89 L A -0.9777
90 A A 0.0000
91 V A -0.3021
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A 0.2226
99 S A -0.2499
100 Y A -0.2754
101 P A -0.7422
102 F A 0.0000
103 T A 0.0892
104 F A 0.2436
105 G A 0.0000
106 S A -0.4654
107 G A 0.0000
108 T A 0.0000
109 K A -0.9875
110 L A 0.0000
111 E A -1.3793
112 I A 0.0000
113 K A -2.1994
114 G A -1.6537
115 G A -1.7313
116 G A -1.3086
117 G A -1.3107
118 S A -1.1923
119 G A -1.5816
120 G A -1.4300
121 G A -1.5130
122 G A -1.2490
123 S A -1.1933
124 G A -1.2362
125 G A -1.3104
126 G A -1.2947
127 G A -1.4897
128 S A -1.3116
129 Q A -1.7543
130 V A -1.1975
131 Q A -1.8661
132 L A 0.0000
133 Q A -2.1329
134 Q A -1.4888
135 P A -1.0747
136 G A -1.0323
137 A A -0.1913
138 E A -0.2080
139 L A 0.8051
140 V A 0.0000
141 R A -1.8679
142 P A -1.3790
143 G A -1.2199
144 A A -1.0020
145 S A -1.2408
146 V A 0.0000
147 K A -2.0941
148 L A 0.0000
149 S A -0.8936
150 C A 0.0000
151 K A -1.4950
152 A A 0.0000
153 S A -1.0888
154 G A -0.9766
155 Y A -0.3276
156 T A -0.0290
157 F A 0.0000
158 T A -0.5752
159 S A 0.1147
160 Y A 0.3719
161 W A 0.0000
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 K A -0.7136
167 Q A -1.0247
168 R A -1.5669
169 P A -1.1052
170 G A -1.3425
171 Q A -1.9216
172 G A -1.2022
173 L A 0.0000
174 E A -1.2702
175 W A 0.0000
176 I A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A -0.2395
181 P A 0.0000
182 S A -1.0681
183 D A -1.5342
184 S A -0.9920
185 Y A -0.2075
186 T A -0.0405
187 N A -0.1768
188 Y A -1.1018
189 N A 0.0000
190 Q A -3.0613
191 K A -3.1474
192 F A 0.0000
193 K A -3.5043
194 D A -3.2634
195 K A -2.2879
196 A A 0.0000
197 T A -1.1404
198 L A 0.0000
199 T A -0.4352
200 V A -0.8156
201 D A -1.4847
202 K A -2.0464
203 S A -1.2067
204 S A -1.0151
205 S A -1.1187
206 T A 0.0000
207 A A 0.0000
208 Y A -0.5486
209 M A 0.0000
210 Q A -1.5052
211 L A 0.0000
212 S A -1.2093
213 S A -1.1269
214 P A 0.0000
215 T A -1.2581
216 S A -1.3501
217 E A -1.9931
218 D A 0.0000
219 S A -0.6802
220 A A 0.0000
221 V A -0.2352
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 T A 0.0000
226 R A 0.0000
227 S A 0.0000
228 W A 0.1782
229 R A -0.5157
230 G A 0.0000
231 N A 0.0000
232 S A 0.0000
233 F A 0.0000
234 D A -0.3748
235 Y A -0.2527
236 W A -0.7403
237 G A 0.0000
238 Q A -1.8259
239 G A 0.0000
240 T A 0.0000
241 T A -0.2309
242 L A 0.0000
243 T A -0.1213
244 V A -0.6485
245 S A -0.4988
246 S A -0.8774
1 D B -2.0419
2 Q B -1.3853
3 W B 0.1164
4 S B -0.4200
5 T B -1.0194
6 Q B -1.5060
7 D B -1.9532
8 L B -0.4149
9 Y B 0.0960
10 N B -0.6836
11 N B -1.2698
12 P B -0.9532
13 V B -0.5333
14 T B -0.3891
15 A B 0.2714
16 V B 1.0045
17 F B 0.9082
18 N B -0.0035
19 Y B 0.4579
20 Q B -0.7531
21 G B -0.3068
22 L B 1.1587
23 W B 1.3350
24 R B 0.4068
25 S B 0.2788
26 C B 0.0000
27 V B -0.7117
28 R B -0.6839
29 E B 0.0000
30 S B -0.0486
31 S B 0.0000
32 G B -0.0855
33 F B -0.1160
34 T B -0.9454
35 E B -2.1542
36 C B -1.1633
37 R B -1.4391
38 G B 0.5566
39 Y B 2.1960
40 F B 3.1713
41 T B 1.8537
42 L B 2.6766
43 L B 3.0713
44 G B 1.5626
45 L B 1.6938
46 P B 0.8962
47 A B 0.6318
48 M B 1.2753
49 L B 0.9570
50 Q B -0.3668
51 A B 0.3191
52 V B 0.9611
53 R B -1.0828
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4126 5.8502 View CSV PDB
4.5 -0.4543 5.8502 View CSV PDB
5.0 -0.5007 5.8502 View CSV PDB
5.5 -0.5448 5.8502 View CSV PDB
6.0 -0.5788 5.8502 View CSV PDB
6.5 -0.5963 5.8502 View CSV PDB
7.0 -0.5972 5.8502 View CSV PDB
7.5 -0.5867 5.8502 View CSV PDB
8.0 -0.5688 5.85 View CSV PDB
8.5 -0.5439 5.8496 View CSV PDB
9.0 -0.5118 5.8482 View CSV PDB