Project name: HS_F1

Status: done

Started: 2026-03-27 01:09:07
Chain sequence(s) A: DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFEMHWVRQAPEKGLEWVAYISSGSTTIYYADTVKGRFTISRDNPKNTLFLQMSSLRSEDTAMYYCVRYSWGYYTMDHWGQGTSVTVSS
B: DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGDTYLHWYLQKPGQSPKLLIYKVSNRFFGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:17)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:30:08)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:30:09)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:30:10)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:30:11)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:30:12)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:30:13)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:30:14)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:30:16)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:30:17)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:30:18)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:30:19)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:30:20)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:30:21)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:30:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:30:27)
Show buried residues

Minimal score value
-4.274
Maximal score value
1.9796
Average score
-0.4944
Total score value
-114.6959

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -0.1728
2 V A 0.5045
3 Q A -0.3942
4 L A 0.0000
5 V A 1.3428
6 E A 0.0000
7 S A -0.3862
8 G A -0.9103
9 G A -0.9749
10 G A 0.0000
11 L A 0.9651
12 V A 0.0000
13 Q A -0.3835
14 P A -0.4553
15 G A -0.5939
16 G A -0.4320
17 S A -0.8500
18 R A 0.0000
19 K A -1.8110
20 L A 0.0000
21 S A -0.3603
22 C A 0.0000
23 A A 0.1987
24 A A 0.0000
25 S A -0.1113
26 G A -0.2807
27 F A -0.0809
28 T A -0.6591
29 F A 0.0000
30 S A -0.6603
31 S A -0.0796
32 F A 0.0000
33 E A -0.1513
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 A A 0.0000
41 P A -1.4807
42 E A -2.6122
43 K A -2.1431
44 G A -1.1747
45 L A 0.0000
46 E A 0.0000
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 Y A 0.9138
51 I A 0.0000
52 S A 0.0673
53 S A -0.6129
54 G A -0.9015
55 S A -0.5403
56 T A -0.0983
57 T A 0.4775
58 I A 1.5762
59 Y A 1.9796
60 Y A 1.3073
61 A A 0.6555
62 D A -0.2448
63 T A -0.6582
64 V A 0.0000
65 K A -1.3555
66 G A -1.1233
67 R A -2.0270
68 F A 0.0000
69 T A -0.3331
70 I A 0.0000
71 S A -0.3618
72 R A 0.0000
73 D A -2.1401
74 N A -1.9404
75 P A -1.7119
76 K A -2.5320
77 N A -1.8371
78 T A -0.9384
79 L A 0.0000
80 F A -0.5045
81 L A 0.0000
82 Q A -1.6166
83 M A 0.0000
84 S A -0.9083
85 S A -0.2188
86 L A 0.5435
87 R A 0.0000
88 S A -0.7762
89 E A -1.4168
90 D A -2.3067
91 T A -1.2984
92 A A 0.0000
93 M A -0.2997
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 V A 0.0000
98 R A 0.0000
99 Y A 0.1448
100 S A 0.5101
101 W A 1.1315
102 G A 0.4768
103 Y A 1.1419
104 Y A 0.0000
105 T A 0.0000
106 M A 0.0000
107 D A 0.0656
108 H A -0.4270
109 W A -0.2839
110 G A 0.0000
111 Q A -0.5660
112 G A -0.1969
113 T A 0.0000
114 S A -0.0953
115 V A 0.0000
116 T A -0.0612
117 V A 0.0168
118 S A -0.3825
119 S A -0.3445
1 D B -1.5582
2 V B -0.0585
3 V B 0.1561
4 M B 0.0000
5 T B -0.6164
6 Q B -0.6283
7 T B -0.2205
8 P B 0.5042
9 L B 1.3514
10 S B 0.0855
11 L B -0.2435
12 P B -1.3096
13 V B 0.0000
14 S B -2.3527
15 L B 0.0000
16 G B -3.0457
17 D B -3.0558
18 Q B -2.5128
19 A B 0.0000
20 S B -0.6798
21 I B 0.0000
22 S B -1.1233
23 C B 0.0000
24 R B -2.4767
25 S B 0.0000
26 S B -1.1105
27 Q B -0.9573
28 S B -0.4200
29 L B 0.0000
30 V B 1.0718
31 H B 0.0000
32 S B -0.8081
33 N B -1.4218
34 G B -1.1474
35 D B -0.8200
36 T B -0.1696
37 Y B 0.0000
38 L B 0.0000
39 H B 0.0000
40 W B 0.0000
41 Y B 0.0000
42 L B 0.0000
43 Q B 0.0000
44 K B -1.7569
45 P B -1.0539
46 G B -0.7892
47 Q B 0.0000
48 S B -0.7771
49 P B 0.0000
50 K B -0.6425
51 L B 0.0000
52 L B 0.0000
53 I B 0.0000
54 Y B 0.0000
55 K B 0.0000
56 V B -0.2625
57 S B -0.3710
58 N B -1.0795
59 R B -0.1766
60 F B 1.1528
61 F B 1.2038
62 G B 0.4526
63 V B -0.0620
64 P B 0.0000
65 D B -2.9592
66 R B -2.8904
67 F B -1.4619
68 S B -0.9581
69 G B -0.8163
70 S B -0.8276
71 G B -1.0048
72 S B -1.1254
73 G B -1.0461
74 T B -1.3948
75 D B -2.1968
76 F B 0.0000
77 T B -1.0432
78 L B 0.0000
79 K B -1.5328
80 I B 0.0000
81 S B -3.1194
82 R B -4.0366
83 V B 0.0000
84 E B -3.7927
85 A B 0.0000
86 E B -3.1029
87 D B -1.6601
88 L B 0.0000
89 G B -1.6129
90 V B 0.0000
91 Y B 0.0000
92 F B 0.0000
93 C B 0.0000
94 S B 0.0000
95 Q B 0.0000
96 S B 0.0000
97 T B 0.0000
98 H B -0.5550
99 V B -0.0570
100 P B -0.1388
101 Y B 0.0000
102 T B 0.0000
103 F B 0.0000
104 G B 0.0000
105 G B 0.0000
106 G B -0.8245
107 T B 0.0000
108 K B -1.1139
109 L B 0.0000
110 E B -2.8375
111 I B -2.9278
112 K B -3.4570
113 R B -4.2740
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.4944 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_7 -0.4944 View CSV PDB
model_0 -0.5095 View CSV PDB
model_10 -0.5351 View CSV PDB
model_8 -0.5607 View CSV PDB
model_6 -0.5633 View CSV PDB
input -0.5733 View CSV PDB
model_2 -0.575 View CSV PDB
CABS_average -0.5764 View CSV PDB
model_5 -0.578 View CSV PDB
model_3 -0.5818 View CSV PDB
model_4 -0.5948 View CSV PDB
model_1 -0.6187 View CSV PDB
model_11 -0.6483 View CSV PDB
model_9 -0.6579 View CSV PDB