Project name: bba71ffce35f6c

Status: done

Started: 2026-08-12 05:59:35
Chain sequence(s) A: QVKLQESGGGLVQPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEFVANINGNGGKTYYPGSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRVAFDGYYDDFWGQGTTVTVSSGGGGSGGGGSGGGGSDIELTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPPTFGGGTKLEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:09)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/bba71ffce35f6c/tmp/folded.pdb                 (00:02:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:03)
Show buried residues

Minimal score value
-3.5085
Maximal score value
1.1323
Average score
-0.7931
Total score value
-191.1334

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5329
2 V A -0.9160
3 K A -1.6264
4 L A 0.0000
5 Q A -1.2329
6 E A 0.0000
7 S A -0.8411
8 G A -0.8768
9 G A -0.3916
10 G A 0.2361
11 L A 1.1323
12 V A 0.0000
13 Q A -1.4453
14 P A -1.5696
15 G A -1.2467
16 G A 0.0000
17 S A -1.0727
18 L A -0.8680
19 K A -1.8923
20 L A 0.0000
21 S A -0.6723
22 C A 0.0000
23 A A -0.8308
24 A A 0.0000
25 S A -1.1530
26 G A -1.0428
27 F A -0.5716
28 T A -0.5486
29 F A 0.0000
30 S A -1.4636
31 N A -1.2738
32 Y A -0.4821
33 G A -0.7904
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A -2.0972
41 P A -2.1080
42 D A -3.2099
43 K A -3.5085
44 R A -3.1086
45 L A 0.0000
46 E A -1.1175
47 F A 0.0000
48 V A 0.0000
49 A A 0.0000
50 N A -0.2058
51 I A 0.0000
52 N A -1.7648
53 G A -1.6398
54 N A -2.3771
55 G A -1.9136
56 G A -1.9109
57 K A -2.2764
58 T A -0.8757
59 Y A 0.0344
60 Y A -0.2695
61 P A -0.8709
62 G A -1.5233
63 S A -1.4040
64 V A 0.0000
65 K A -2.1381
66 G A -1.5615
67 R A -1.3778
68 F A 0.0000
69 T A -0.8485
70 I A 0.0000
71 S A -0.7023
72 R A -1.1737
73 D A -1.5712
74 N A -1.9220
75 A A -1.3220
76 K A -2.2204
77 N A -1.6045
78 T A -1.1332
79 L A 0.0000
80 Y A -0.4536
81 L A 0.0000
82 Q A -1.4183
83 M A 0.0000
84 S A -1.0218
85 S A -0.9449
86 L A 0.0000
87 K A -2.1210
88 S A -1.8835
89 E A -2.4958
90 D A 0.0000
91 T A -0.7166
92 A A 0.0000
93 M A -0.1909
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 V A 0.0000
98 R A 0.0000
99 V A 0.0000
100 A A 0.0000
101 F A 1.1075
102 D A -0.2590
103 G A -0.0657
104 Y A 0.4851
105 Y A 0.3489
106 D A 0.0000
107 D A 0.1873
108 F A 0.3615
109 W A -0.5260
110 G A 0.0000
111 Q A -2.0254
112 G A 0.0000
113 T A -0.4970
114 T A 0.0804
115 V A 0.0000
116 T A -0.1266
117 V A 0.0000
118 S A -0.9871
119 S A -1.3867
120 G A -1.1937
121 G A -1.1026
122 G A -1.1206
123 G A -1.1436
124 S A -0.8775
125 G A -1.1080
126 G A -1.3850
127 G A -1.3840
128 G A -1.4061
129 S A -1.0363
130 G A -1.2731
131 G A -1.5803
132 G A -1.4317
133 G A -1.5404
134 S A -1.5886
135 D A -2.3291
136 I A 0.0000
137 E A -2.8770
138 L A 0.0000
139 T A -1.5282
140 Q A -1.0636
141 S A -0.7179
142 P A -0.3726
143 A A -0.3351
144 T A -0.4610
145 L A -0.3570
146 S A -0.7422
147 V A 0.0000
148 T A -1.3588
149 P A -1.7271
150 G A -1.8599
151 D A -2.3574
152 R A -2.8281
153 V A 0.0000
154 S A -0.7070
155 L A 0.0000
156 S A -0.9436
157 C A 0.0000
158 R A -2.9699
159 A A 0.0000
160 S A -2.2368
161 Q A -2.2611
162 S A -1.4941
163 I A 0.0000
164 S A -1.0802
165 D A -1.4845
166 Y A -0.3573
167 L A 0.0000
168 H A 0.0000
169 W A 0.0000
170 Y A 0.0000
171 Q A 0.0000
172 Q A 0.0000
173 K A -1.9183
174 S A -1.4354
175 H A -2.3000
176 E A -3.0405
177 S A -1.8233
178 P A 0.0000
179 R A -1.5731
180 L A 0.0000
181 L A 0.0000
182 I A 0.0000
183 K A -0.5986
184 Y A -0.6198
185 A A 0.0000
186 S A -1.0544
187 Q A -1.3520
188 S A -0.7493
189 I A -0.3076
190 S A -0.4289
191 G A -0.5380
192 I A 0.0000
193 P A -0.4014
194 S A -0.6019
195 R A -1.1049
196 F A 0.0000
197 S A -0.7109
198 G A 0.0000
199 S A -0.9283
200 G A -1.3374
201 S A -1.3584
202 G A -1.4061
203 S A -1.9203
204 D A -2.3669
205 F A 0.0000
206 T A -0.8358
207 L A 0.0000
208 S A -0.8223
209 I A 0.0000
210 N A -2.1853
211 S A -2.0423
212 V A 0.0000
213 E A -1.9597
214 P A -1.5271
215 E A -2.0747
216 D A 0.0000
217 V A -0.6433
218 G A 0.0000
219 V A -0.7246
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 Q A 0.0000
224 N A 0.0000
225 G A 0.0952
226 H A -0.2680
227 S A 0.0999
228 F A 0.9131
229 P A 0.0000
230 P A -0.1504
231 T A -0.7624
232 F A 0.0000
233 G A 0.0000
234 G A -1.7957
235 G A -1.1036
236 T A 0.0000
237 K A -1.1129
238 L A 0.0000
239 E A -1.0100
240 I A -0.8488
241 K A -1.6336
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7579 3.9498 View CSV PDB
4.5 -0.7961 3.7912 View CSV PDB
5.0 -0.8401 3.6299 View CSV PDB
5.5 -0.8816 3.468 View CSV PDB
6.0 -0.9111 3.3065 View CSV PDB
6.5 -0.9214 3.147 View CSV PDB
7.0 -0.9134 2.9937 View CSV PDB
7.5 -0.8926 2.8572 View CSV PDB
8.0 -0.8632 2.7548 View CSV PDB
8.5 -0.8272 2.6968 View CSV PDB
9.0 -0.7859 2.6717 View CSV PDB