Project name: bbf155d35ceb62f [mutate: VY107H] [mutate: VS107H] [mutate: FY108H]

Status: done

Started: 2026-08-14 17:01:42
Chain sequence(s) H: QVQLVESGGGLVQPGGSLRLSCAASGGDFSQYSLGWFRQAPGQGLEAVAAISADGSTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAGLDTGSTFVFSYWGQGTLVTVS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues FY108H
Energy difference between WT (input) and mutated protein (by FoldX) 1.5336 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:20)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:21)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:25)
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:21)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)
Show buried residues

Minimal score value
-3.1448
Maximal score value
1.8604
Average score
-0.5867
Total score value
-70.4009

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q H -2.0126
2 V H 0.0000
3 Q H -1.3319
4 L H 0.0000
5 V H 1.2250
6 E H 0.0000
7 S H -0.2077
8 G H -0.8051
9 G H 0.1155
10 G H 0.7009
11 L H 1.4324
12 V H -0.0716
13 Q H -1.3803
14 P H -1.7219
15 G H -1.4997
16 G H -0.9922
17 S H -1.2102
18 L H -0.8602
19 R H -2.1199
20 L H 0.0000
21 S H -0.4089
22 C H 0.0000
23 A H -0.0441
24 A H 0.0000
25 S H -1.4495
26 G H -1.9550
27 G H -2.3628
28 D H -2.7762
29 F H 0.0000
30 S H -2.3381
31 Q H -1.8079
32 Y H -0.7948
33 S H 0.0000
34 L H 0.0000
35 G H 0.0000
36 W H 0.0000
37 F H -0.0404
38 R H -0.3829
39 Q H -0.7951
40 A H -1.0777
41 P H -0.9963
42 G H -1.2537
43 Q H -1.8844
44 G H -1.2479
45 L H -0.3783
46 E H -1.4974
47 A H -0.4518
48 V H 0.0000
49 A H 0.0000
50 A H 0.0000
51 I H 0.0000
52 S H -0.8377
53 A H -1.4730
54 D H -2.3845
55 G H -1.4979
56 S H -0.8962
57 T H -0.3602
58 T H 0.3470
59 Y H 0.5357
60 Y H -0.3955
61 A H -1.3456
62 D H -2.3566
63 S H -1.7968
64 V H 0.0000
65 K H -2.3879
66 G H -1.6225
67 R H 0.0000
68 F H 0.0000
69 T H -0.7302
70 I H 0.0000
71 S H -0.5655
72 R H 0.0000
73 D H -2.4449
74 N H -3.1448
75 S H -2.0650
76 K H -2.7283
77 N H -2.4457
78 T H -1.2408
79 L H 0.0000
80 Y H 0.0000
81 L H 0.0000
82 Q H -1.2600
83 M H 0.0000
84 N H -1.3464
85 S H -1.2299
86 L H 0.0000
87 R H -2.7003
88 A H -1.9328
89 E H -2.3932
90 D H 0.0000
91 T H -0.4978
92 A H 0.0000
93 V H 0.9351
94 Y H 0.0000
95 Y H 0.3997
96 C H 0.0000
97 A H 0.0000
98 A H 0.0000
99 G H 0.0000
100 L H 0.7365
101 D H -0.2817
102 T H -0.2513
103 G H -0.5880
104 S H -0.3254
105 T H 0.0941
106 F H 0.8375
107 V H 1.8604
108 Y H 1.2560 mutated: FY108H
109 S H 0.7083
110 Y H 0.3248
111 W H 0.4281
112 G H 0.0043
113 Q H -0.6346
114 G H 0.1667
115 T H 0.6453
116 L H 1.6249
117 V H 0.0000
118 T H 0.3515
119 V H 0.0000
120 S H -0.8131
Download PDB file
View in 3Dmol