Project name: bc133b78e409e1f

Status: done

Started: 2026-02-17 14:38:53
Chain sequence(s) A: MNAAVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWADVGGWTGQGGTLLGTKRTLPGKHVDKIAEQMRMHNINALLIIGGFEAFLSLLELLTARGKYDEFCVPMVMVPATVSNNVPGSDLSIGADTALNAITATCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGADAAYIYEEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENCNDNYTTDFIYQLYSEEGRGGV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:03)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/bc133b78e409e1f/tmp/folded.pdb                (00:00:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:20)
Show buried residues

Minimal score value
-4.1285
Maximal score value
2.504
Average score
-0.7375
Total score value
-175.5356

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.4110
2 N A 0.0000
3 A A -0.3652
4 A A 0.2889
5 V A 0.5454
6 R A -0.5023
7 S A 0.2863
8 A A 0.6020
9 V A 0.0000
10 R A -0.0042
11 V A 1.0926
12 G A -0.3438
13 I A -0.6850
14 S A -0.6801
15 E A -2.0439
16 G A -1.8332
17 H A -2.2352
18 K A -2.6850
19 M A -1.1104
20 F A -0.9017
21 A A 0.0000
22 V A -0.6728
23 N A -1.0980
24 D A -1.6176
25 G A -1.2930
26 F A 0.0000
27 E A -1.5928
28 G A 0.0000
29 F A 0.0000
30 Y A -1.7705
31 K A -2.0897
32 G A -1.5997
33 Q A -1.5949
34 I A -1.2779
35 K A -2.1432
36 E A -2.1482
37 I A 0.0000
38 K A -2.2290
39 W A -0.2137
40 A A -0.9640
41 D A -2.0086
42 V A 0.0000
43 G A -1.0720
44 G A -1.1544
45 W A -0.8725
46 T A -0.8693
47 G A -1.2639
48 Q A -1.5659
49 G A -1.1482
50 G A -0.6631
51 T A 0.1152
52 L A 0.9634
53 L A 0.5394
54 G A -0.3457
55 T A -1.3261
56 K A -2.6500
57 R A -2.5995
58 T A -1.6651
59 L A -0.7070
60 P A 0.0000
61 G A -1.1159
62 K A -2.1488
63 H A -1.8690
64 V A -1.7531
65 D A -2.6094
66 K A -2.8206
67 I A 0.0000
68 A A 0.0000
69 E A -2.5982
70 Q A -1.9444
71 M A 0.0000
72 R A -2.8650
73 M A -0.7186
74 H A -1.4275
75 N A -2.1555
76 I A -1.4284
77 N A -1.8832
78 A A -0.0323
79 L A 0.9879
80 L A 1.7798
81 I A 1.5415
82 I A 1.2813
83 G A 0.2827
84 G A 0.3278
85 F A 0.4302
86 E A -0.2738
87 A A 0.0000
88 F A 1.4250
89 L A 1.2283
90 S A 0.0000
91 L A 1.5906
92 L A 1.5051
93 E A 0.4014
94 L A 0.0000
95 L A 1.5972
96 T A 0.1748
97 A A 0.0000
98 R A -1.1735
99 G A -1.5171
100 K A -2.4848
101 Y A -1.8876
102 D A -2.3472
103 E A -2.2384
104 F A 0.0000
105 C A -0.1859
106 V A 0.1134
107 P A 0.4008
108 M A 1.4527
109 V A 2.5040
110 M A 1.8706
111 V A 1.5553
112 P A 0.7965
113 A A 0.0000
114 T A 0.6668
115 V A 0.7827
116 S A 0.7465
117 N A -0.0636
118 N A -0.2290
119 V A 0.0000
120 P A -0.5318
121 G A -0.8252
122 S A -0.7869
123 D A -1.3330
124 L A 0.4722
125 S A 0.5541
126 I A 1.1383
127 G A 0.1542
128 A A 0.0000
129 D A -1.5407
130 T A -1.0830
131 A A -0.4450
132 L A -0.7726
133 N A -1.5837
134 A A -0.8167
135 I A -0.4490
136 T A -0.6895
137 A A -1.2029
138 T A -1.2572
139 C A 0.0000
140 D A -2.7515
141 R A -2.9688
142 I A -1.5535
143 K A -2.2176
144 Q A -2.5373
145 S A -1.6349
146 A A 0.0000
147 S A -1.7030
148 G A -1.2899
149 T A -1.8643
150 K A -2.8674
151 R A -2.8286
152 R A -2.2941
153 V A -0.3916
154 F A 0.5831
155 I A 0.4204
156 I A -0.0752
157 E A -1.5166
158 T A 0.0000
159 M A 0.7887
160 G A 0.0000
161 G A 0.7154
162 Y A 1.1619
163 C A 0.5502
164 G A 0.0000
165 Y A 0.6973
166 L A 0.0000
167 A A 0.0000
168 S A 0.8038
169 V A 1.0411
170 G A 0.0000
171 G A 0.0000
172 L A 1.5353
173 A A 0.7044
174 A A 0.0000
175 G A -0.1311
176 A A 0.0728
177 D A -0.7898
178 A A -0.1607
179 A A -0.0983
180 Y A 0.0000
181 I A -0.2242
182 Y A -0.1930
183 E A -1.7764
184 E A -2.2961
185 P A -1.4029
186 F A -0.9958
187 D A -1.0283
188 I A -0.5936
189 R A -2.4426
190 D A -2.4210
191 L A 0.0000
192 Q A -2.9272
193 A A -2.3195
194 N A -2.3695
195 V A 0.0000
196 E A -3.5977
197 H A -2.8901
198 L A 0.0000
199 T A -3.0708
200 E A -3.3855
201 K A -2.3503
202 M A -2.3169
203 K A -2.1507
204 T A -1.0887
205 S A -0.2768
206 I A 0.2022
207 Q A -1.9256
208 R A -2.0714
209 G A 0.0000
210 L A 0.0000
211 V A 0.0000
212 L A 0.0000
213 R A 0.0000
214 N A 0.0000
215 E A -0.7340
216 N A -0.6733
217 C A 0.0000
218 N A -1.2939
219 D A -2.5458
220 N A -2.2425
221 Y A -0.8557
222 T A -1.4728
223 T A -1.0180
224 D A -1.5092
225 F A -0.2695
226 I A 0.0000
227 Y A 0.3949
228 Q A -1.5222
229 L A -1.1891
230 Y A 0.0000
231 S A -1.9448
232 E A -3.4871
233 E A -4.1285
234 G A -3.2285
235 R A -3.2003
236 G A -1.5617
237 G A -1.2181
238 V A 0.7651
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4933 3.0801 View CSV PDB
4.5 -0.5768 3.0303 View CSV PDB
5.0 -0.6757 3.0247 View CSV PDB
5.5 -0.7728 3.0247 View CSV PDB
6.0 -0.851 3.0247 View CSV PDB
6.5 -0.8986 3.0247 View CSV PDB
7.0 -0.9161 3.0247 View CSV PDB
7.5 -0.914 3.0247 View CSV PDB
8.0 -0.9005 3.0247 View CSV PDB
8.5 -0.8768 3.0247 View CSV PDB
9.0 -0.8404 3.0247 View CSV PDB