Project name: bc4414f417d9494

Status: done

Started: 2026-04-13 11:46:21
Chain sequence(s) A: MKRIAIVLARSNSKRLPDKYLRLFAGKPMIAFPIEAALKSGLFDKVYISSDDQRIIDVAKKYGAEYTKLRPAELADENATTLDVVSFEVKELNLKDDDIVCCIYGAAVFLTPEDIKRAYDALKSDTDFVFFVYKFLYPCLRAFTLENGVVLIYPEYFNTRTQDLPTQYADAGLLYMGYAKSFREKKPIFSPKSKAIVKPAARVQDIDDEEDLALARLLYAAQAAASA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:54)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/bc4414f417d9494/tmp/folded.pdb                (00:04:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:39)
Show buried residues

Minimal score value
-3.6766
Maximal score value
3.2509
Average score
-0.7063
Total score value
-160.3198

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.3865
2 K A -1.3994
3 R A -1.3142
4 I A 0.0000
5 A A 0.0000
6 I A 0.0000
7 V A 0.0000
8 L A 0.0000
9 A A 0.0000
10 R A -1.4207
11 S A -1.9514
12 N A -2.9480
13 S A -2.9374
14 K A -3.3972
15 R A -3.6766
16 L A 0.0000
17 P A -2.4165
18 D A -2.2532
19 K A -1.6744
20 Y A -0.2754
21 L A -0.2852
22 R A -0.0597
23 L A 0.9313
24 F A 0.0000
25 A A -0.2120
26 G A -0.5034
27 K A -0.6491
28 P A 0.1341
29 M A 0.0000
30 I A 0.0000
31 A A 0.0000
32 F A -0.0943
33 P A 0.0000
34 I A 0.0000
35 E A -1.0337
36 A A 0.0000
37 A A 0.0000
38 L A -0.8949
39 K A -1.9711
40 S A 0.0000
41 G A -1.3096
42 L A 0.0000
43 F A -1.3816
44 D A -2.2173
45 K A -1.9442
46 V A 0.0000
47 Y A 0.0000
48 I A 0.0000
49 S A 0.0000
50 S A 0.0000
51 D A -1.3955
52 D A -1.5333
53 Q A -2.0035
54 R A -2.5155
55 I A 0.0000
56 I A 0.0000
57 D A -2.5585
58 V A -1.6420
59 A A 0.0000
60 K A -2.8237
61 K A -2.6063
62 Y A -1.5052
63 G A -1.6416
64 A A 0.0000
65 E A -2.3376
66 Y A -0.9645
67 T A -0.8371
68 K A -1.3223
69 L A -0.2153
70 R A 0.0000
71 P A -0.7458
72 A A -1.1329
73 E A -2.5761
74 L A -1.6687
75 A A 0.0000
76 D A -3.2888
77 E A -3.4803
78 N A -2.8209
79 A A -1.9052
80 T A -0.9897
81 T A -0.2325
82 L A -0.8053
83 D A -1.0371
84 V A 0.0000
85 V A 0.0000
86 S A -1.5198
87 F A -0.8553
88 E A 0.0000
89 V A 0.0000
90 K A -2.8927
91 E A -2.4047
92 L A -1.6698
93 N A -2.6343
94 L A 0.0000
95 K A -3.3125
96 D A -3.2064
97 D A -2.8504
98 D A 0.0000
99 I A 0.0000
100 V A 0.0000
101 C A 0.0000
102 C A 0.0000
103 I A 0.0000
104 Y A 0.0705
105 G A 0.0000
106 A A 0.0000
107 A A 0.0000
108 V A 0.0000
109 F A 0.0000
110 L A 0.0000
111 T A -1.5725
112 P A -2.1463
113 E A -3.0415
114 D A -2.2480
115 I A 0.0000
116 K A -3.2636
117 R A -3.4893
118 A A 0.0000
119 Y A -2.0630
120 D A -2.9051
121 A A -2.0973
122 L A 0.0000
123 K A -2.7682
124 S A -2.1295
125 D A -2.7179
126 T A -2.2561
127 D A 0.0000
128 F A 0.0000
129 V A 0.0000
130 F A 0.0000
131 F A 0.0000
132 V A 0.0000
133 Y A 0.2835
134 K A 0.2349
135 F A 1.5784
136 L A 2.3452
137 Y A 2.1009
138 P A 0.7347
139 C A 1.3903
140 L A 1.0102
141 R A 0.8622
142 A A 1.9882
143 F A 3.2509
144 T A 1.9703
145 L A 1.5080
146 E A -1.0257
147 N A -1.3990
148 G A 0.2033
149 V A 2.5157
150 V A 2.5421
151 L A 2.8970
152 I A 2.7741
153 Y A 1.5329
154 P A 0.5210
155 E A -1.0296
156 Y A -0.1930
157 F A 0.8480
158 N A -1.0776
159 T A -1.7719
160 R A -2.8697
161 T A -2.0709
162 Q A -2.7415
163 D A -3.0310
164 L A 0.0000
165 P A -0.8777
166 T A -0.2940
167 Q A 0.3148
168 Y A 0.7786
169 A A 0.1994
170 D A -0.2361
171 A A 0.0000
172 G A -0.6391
173 L A 0.0000
174 L A 0.0000
175 Y A 0.0000
176 M A 0.0000
177 G A 0.0000
178 Y A -1.5652
179 A A 0.0000
180 K A -3.0274
181 S A 0.0000
182 F A 0.0000
183 R A -2.8534
184 E A -3.3072
185 K A -2.8620
186 K A -2.0526
187 P A -0.6247
188 I A 0.2614
189 F A 1.3082
190 S A -0.0123
191 P A -0.7980
192 K A -1.9380
193 S A -1.3972
194 K A -1.3848
195 A A 0.0624
196 I A 0.1851
197 V A 0.9510
198 K A 0.0000
199 P A -0.5553
200 A A -0.2829
201 A A -0.7601
202 R A -1.6495
203 V A 0.0000
204 Q A -1.5204
205 D A -2.2219
206 I A 0.0000
207 D A -3.0931
208 D A -3.3223
209 E A -2.9183
210 E A -2.7578
211 D A -2.1737
212 L A 0.0000
213 A A -0.5196
214 L A 0.2334
215 A A 0.0000
216 R A 0.0495
217 L A 1.5700
218 L A 0.7284
219 Y A 0.4017
220 A A 0.5562
221 A A 0.3758
222 Q A -0.2752
223 A A 0.1571
224 A A 0.0328
225 A A -0.0747
226 S A -0.2184
227 A A -0.0541
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3842 6.129 View CSV PDB
4.5 -0.468 6.0927 View CSV PDB
5.0 -0.5685 6.0425 View CSV PDB
5.5 -0.6667 5.987 View CSV PDB
6.0 -0.7427 5.9345 View CSV PDB
6.5 -0.7827 5.894 View CSV PDB
7.0 -0.7864 5.8704 View CSV PDB
7.5 -0.765 5.8602 View CSV PDB
8.0 -0.7293 5.8564 View CSV PDB
8.5 -0.6824 5.855 View CSV PDB
9.0 -0.6227 5.854 View CSV PDB