| Chain sequence(s) |
A: SYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVH
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| pH calculations | No |
| alphaCutter usage | No |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimization (00:00:01)
[INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:02:59)
[INFO] AutoMut: Residue number 205 from chain A and a score of 1.756 (valine) selected for
automated mutation (00:03:00)
[INFO] AutoMut: Residue number 204 from chain A and a score of 1.222 (methionine) selected
for automated mutation (00:03:00)
[INFO] AutoMut: Residue number 118 from chain A and a score of 1.105 (isoleucine) selected
for automated mutation (00:03:00)
[INFO] AutoMut: Residue number 202 from chain A and a score of 0.749 (leucine) selected for
automated mutation (00:03:00)
[INFO] AutoMut: Residue number 203 from chain A and a score of 0.730 (proline) selected for
automated mutation (00:03:00)
[INFO] AutoMut: Residue number 206 from chain A and a score of 0.673 (valine) selected for
automated mutation (00:03:00)
[INFO] AutoMut: Mutating residue number 205 from chain A (valine) into glutamic acid (00:03:00)
[INFO] AutoMut: Mutating residue number 205 from chain A (valine) into aspartic acid (00:03:00)
[INFO] AutoMut: Mutating residue number 204 from chain A (methionine) into glutamic acid (00:03:00)
[INFO] AutoMut: Mutating residue number 205 from chain A (valine) into arginine (00:03:09)
[INFO] AutoMut: Mutating residue number 205 from chain A (valine) into lysine (00:03:12)
[INFO] AutoMut: Mutating residue number 204 from chain A (methionine) into lysine (00:03:12)
[INFO] AutoMut: Mutating residue number 204 from chain A (methionine) into aspartic acid (00:03:25)
[INFO] AutoMut: Mutating residue number 118 from chain A (isoleucine) into glutamic acid (00:03:30)
[INFO] AutoMut: Mutating residue number 204 from chain A (methionine) into arginine (00:03:36)
[INFO] AutoMut: Mutating residue number 118 from chain A (isoleucine) into lysine (00:03:42)
[INFO] AutoMut: Mutating residue number 118 from chain A (isoleucine) into aspartic acid (00:03:53)
[INFO] AutoMut: Mutating residue number 202 from chain A (leucine) into glutamic acid (00:04:00)
[INFO] AutoMut: Mutating residue number 118 from chain A (isoleucine) into arginine (00:04:02)
[INFO] AutoMut: Mutating residue number 202 from chain A (leucine) into aspartic acid (00:04:09)
[INFO] AutoMut: Mutating residue number 202 from chain A (leucine) into lysine (00:04:14)
[INFO] AutoMut: Mutating residue number 203 from chain A (proline) into glutamic acid (00:04:18)
[INFO] AutoMut: Mutating residue number 202 from chain A (leucine) into arginine (00:04:20)
[INFO] AutoMut: Mutating residue number 203 from chain A (proline) into aspartic acid (00:04:32)
[INFO] AutoMut: Mutating residue number 203 from chain A (proline) into lysine (00:04:32)
[INFO] AutoMut: Mutating residue number 206 from chain A (valine) into glutamic acid (00:04:37)
[INFO] AutoMut: Mutating residue number 206 from chain A (valine) into aspartic acid (00:04:44)
[INFO] AutoMut: Mutating residue number 203 from chain A (proline) into arginine (00:04:48)
[INFO] AutoMut: Mutating residue number 206 from chain A (valine) into lysine (00:05:01)
[INFO] AutoMut: Mutating residue number 206 from chain A (valine) into arginine (00:05:08)
[INFO] AutoMut: Effect of mutation residue number 205 from chain A (valine) into glutamic
acid: Energy difference: -0.7651 kcal/mol, Difference in average score from
the base case: -0.0933 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 205 from chain A (valine) into lysine:
Energy difference: -0.0064 kcal/mol, Difference in average score from the
base case: -0.0916 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 205 from chain A (valine) into aspartic
acid: Energy difference: -0.7562 kcal/mol, Difference in average score from
the base case: -0.0949 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 205 from chain A (valine) into arginine:
Energy difference: 0.0643 kcal/mol, Difference in average score from the
base case: -0.0951 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 204 from chain A (methionine) into
glutamic acid: Energy difference: 1.5818 kcal/mol, Difference in average
score from the base case: -0.0230 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 204 from chain A (methionine) into
lysine: Energy difference: 0.8921 kcal/mol, Difference in average score
from the base case: -0.0330 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 204 from chain A (methionine) into
aspartic acid: Energy difference: 2.3704 kcal/mol, Difference in average
score from the base case: -0.0392 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 204 from chain A (methionine) into
arginine: Energy difference: 0.8194 kcal/mol, Difference in average score
from the base case: -0.0377 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 118 from chain A (isoleucine) into
glutamic acid: Energy difference: -0.5883 kcal/mol, Difference in average
score from the base case: -0.0690 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 118 from chain A (isoleucine) into
lysine: Energy difference: -0.3373 kcal/mol, Difference in average score
from the base case: -0.0689 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 118 from chain A (isoleucine) into
aspartic acid: Energy difference: -0.5965 kcal/mol, Difference in average
score from the base case: -0.0690 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 118 from chain A (isoleucine) into
arginine: Energy difference: -0.4251 kcal/mol, Difference in average score
from the base case: -0.0715 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 202 from chain A (leucine) into glutamic
acid: Energy difference: 0.8799 kcal/mol, Difference in average score from
the base case: -0.0408 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 202 from chain A (leucine) into lysine:
Energy difference: 0.5523 kcal/mol, Difference in average score from the
base case: -0.0330 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 202 from chain A (leucine) into aspartic
acid: Energy difference: 1.0814 kcal/mol, Difference in average score from
the base case: -0.0294 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 202 from chain A (leucine) into arginine:
Energy difference: 0.5710 kcal/mol, Difference in average score from the
base case: -0.0482 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 203 from chain A (proline) into glutamic
acid: Energy difference: -0.1788 kcal/mol, Difference in average score from
the base case: -0.0067 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 203 from chain A (proline) into lysine:
Energy difference: 2.2266 kcal/mol, Difference in average score from the
base case: -0.0086 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 203 from chain A (proline) into aspartic
acid: Energy difference: 1.5067 kcal/mol, Difference in average score from
the base case: -0.0081 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 203 from chain A (proline) into arginine:
Energy difference: 3.0216 kcal/mol, Difference in average score from the
base case: -0.0117 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 206 from chain A (valine) into glutamic
acid: Energy difference: 1.8645 kcal/mol, Difference in average score from
the base case: -0.0230 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 206 from chain A (valine) into lysine:
Energy difference: 1.2399 kcal/mol, Difference in average score from the
base case: -0.0262 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 206 from chain A (valine) into aspartic
acid: Energy difference: 2.0475 kcal/mol, Difference in average score from
the base case: -0.0196 (00:05:32)
[INFO] AutoMut: Effect of mutation residue number 206 from chain A (valine) into arginine:
Energy difference: 0.7635 kcal/mol, Difference in average score from the
base case: -0.0393 (00:05:32)
[INFO] Main: Simulation completed successfully. (00:05:39)
|
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan4D score | mutation |
|---|---|---|---|---|
| 69 | S | A | -0.2841 | |
| 70 | Y | A | -0.3374 | |
| 71 | N | A | -1.4812 | |
| 72 | H | A | -1.5211 | |
| 73 | L | A | -1.1188 | |
| 74 | Q | A | -1.9942 | |
| 75 | G | A | -2.0428 | |
| 76 | D | A | -2.2844 | |
| 77 | V | A | -0.8575 | |
| 78 | R | A | -0.1951 | |
| 79 | W | A | 0.5480 | |
| 80 | R | A | 0.5896 | |
| 81 | K | A | 0.2816 | |
| 82 | L | A | 0.0000 | |
| 83 | F | A | -0.1130 | |
| 84 | S | A | 0.0000 | |
| 85 | F | A | 0.3534 | |
| 86 | T | A | -0.8614 | |
| 87 | K | A | -1.8348 | |
| 88 | Y | A | -1.8274 | |
| 89 | F | A | 0.0000 | |
| 90 | L | A | 0.0000 | |
| 91 | K | A | -0.7230 | |
| 92 | I | A | 0.0000 | |
| 93 | E | A | -2.4600 | |
| 94 | K | A | -3.0281 | |
| 95 | N | A | -2.7062 | |
| 96 | G | A | -2.3307 | |
| 97 | K | A | -2.2328 | |
| 98 | V | A | 0.0000 | |
| 99 | S | A | -0.7925 | |
| 100 | G | A | -1.2322 | |
| 101 | T | A | -2.2834 | |
| 102 | K | A | -3.4408 | |
| 103 | K | A | -3.8336 | |
| 104 | E | A | -3.6901 | |
| 105 | N | A | -2.9340 | |
| 106 | C | A | 0.0000 | |
| 107 | P | A | -1.0520 | |
| 108 | Y | A | -0.7752 | |
| 109 | S | A | 0.0000 | |
| 110 | I | A | 0.0647 | |
| 111 | L | A | 0.0000 | |
| 112 | E | A | 0.0000 | |
| 113 | I | A | 0.0000 | |
| 114 | T | A | 0.0000 | |
| 115 | S | A | -0.9011 | |
| 116 | V | A | -0.8391 | |
| 117 | E | A | -1.1512 | |
| 118 | I | A | 1.1048 | |
| 119 | G | A | 0.3983 | |
| 120 | V | A | 0.0000 | |
| 121 | V | A | 0.0000 | |
| 122 | A | A | 0.0000 | |
| 123 | V | A | 0.0000 | |
| 124 | K | A | 0.0000 | |
| 125 | A | A | 0.0000 | |
| 126 | I | A | 0.0000 | |
| 127 | N | A | -1.0596 | |
| 128 | S | A | 0.0000 | |
| 129 | N | A | -1.5191 | |
| 130 | Y | A | -1.6104 | |
| 131 | Y | A | 0.0000 | |
| 132 | L | A | 0.0000 | |
| 133 | A | A | 0.0000 | |
| 134 | M | A | 0.0000 | |
| 135 | N | A | -2.4690 | |
| 136 | K | A | -3.3610 | |
| 137 | K | A | -3.5919 | |
| 138 | G | A | 0.0000 | |
| 139 | K | A | -3.1069 | |
| 140 | L | A | 0.0000 | |
| 141 | Y | A | -0.7514 | |
| 142 | G | A | -1.6569 | |
| 143 | S | A | 0.0000 | |
| 144 | K | A | -2.5392 | |
| 145 | E | A | -2.4650 | |
| 146 | F | A | -1.2521 | |
| 147 | N | A | -1.5496 | |
| 148 | N | A | -1.5211 | |
| 149 | D | A | -1.2497 | |
| 150 | C | A | 0.0000 | |
| 151 | K | A | -0.9012 | |
| 152 | L | A | 0.0000 | |
| 153 | K | A | -0.4789 | |
| 154 | E | A | 0.0000 | |
| 155 | R | A | -0.5501 | |
| 156 | I | A | 0.6698 | |
| 157 | E | A | -0.9500 | |
| 158 | E | A | -2.3825 | |
| 159 | N | A | -2.1719 | |
| 160 | G | A | -1.1400 | |
| 161 | Y | A | 0.0000 | |
| 162 | N | A | 0.0000 | |
| 163 | T | A | 0.0000 | |
| 164 | Y | A | 0.0000 | |
| 165 | A | A | 0.0000 | |
| 166 | S | A | 0.0000 | |
| 167 | F | A | -0.2583 | |
| 168 | N | A | -1.0557 | |
| 169 | W | A | -2.0089 | |
| 170 | Q | A | -3.2459 | |
| 171 | H | A | -3.6409 | |
| 172 | N | A | -2.9011 | |
| 173 | G | A | -2.6567 | |
| 174 | R | A | -3.8818 | |
| 175 | Q | A | -2.9917 | |
| 176 | M | A | 0.0000 | |
| 177 | Y | A | 0.0000 | |
| 178 | V | A | 0.0000 | |
| 179 | A | A | 0.0000 | |
| 180 | L | A | 0.0000 | |
| 181 | N | A | -1.3584 | |
| 182 | G | A | -1.6179 | |
| 183 | K | A | -2.2184 | |
| 184 | G | A | 0.0000 | |
| 185 | A | A | -0.9751 | |
| 186 | P | A | -1.3313 | |
| 187 | R | A | -2.0492 | |
| 188 | R | A | -3.0672 | |
| 189 | G | A | 0.0000 | |
| 190 | Q | A | -4.0138 | |
| 191 | K | A | -3.0513 | |
| 192 | T | A | -3.2200 | |
| 193 | R | A | -3.7988 | |
| 194 | R | A | -3.0119 | |
| 195 | K | A | -2.8660 | |
| 196 | N | A | -2.0417 | |
| 197 | T | A | -1.0441 | |
| 198 | S | A | 0.0000 | |
| 199 | A | A | 0.0000 | |
| 200 | H | A | 0.0000 | |
| 201 | F | A | 0.0000 | |
| 202 | L | A | 0.7493 | |
| 203 | P | A | 0.7302 | |
| 204 | M | A | 1.2216 | |
| 205 | V | A | 1.7561 | |
| 206 | V | A | 0.6727 | |
| 207 | H | A | -0.3631 |
Automated mutations analysis - charged mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
| VD205A | -0.7562 | -0.0949 | View | CSV | PDB |
| VE205A | -0.7651 | -0.0933 | View | CSV | PDB |
| ID118A | -0.5965 | -0.069 | View | CSV | PDB |
| IE118A | -0.5883 | -0.069 | View | CSV | PDB |
| PE203A | -0.1788 | -0.0067 | View | CSV | PDB |
| LR202A | 0.571 | -0.0482 | View | CSV | PDB |
| LK202A | 0.5523 | -0.033 | View | CSV | PDB |
| VR206A | 0.7635 | -0.0393 | View | CSV | PDB |
| MR204A | 0.8194 | -0.0377 | View | CSV | PDB |
| MK204A | 0.8921 | -0.033 | View | CSV | PDB |
| VK206A | 1.2399 | -0.0262 | View | CSV | PDB |
| PD203A | 1.5067 | -0.0081 | View | CSV | PDB |