Project name: bcfa61a1dc25f6f

Status: done

Started: 2026-05-20 13:21:43
Chain sequence(s) A: MPIQSIKARQIYDSRGNPTVEVDLVTENGLFRAAVPSGASTGVHEALELRDNDKSKYHGKSVFKAVDNINNIIVPELLKSGLEVTQQTDIDNLLLKIDGTPNKAKLGANAILGVSLAVCKAGAAKKGIPLYKYIAELAGNSNIVLPVPAFNVINGGSHAGNKLAMQEFMILPLGAANFTEAMKMGSEVYHYLKAGIKKKFGLDATAVGDEGGFAPNILENKEALNLIIDAIKTAGYEGKIKIGMDVAASEFHKNGKYDLDFKNEKSDPATYLEPDALKNLYLEWVKGLPHRFY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:02)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/bcfa61a1dc25f6f/tmp/folded.pdb                (00:00:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:45)
Show buried residues

Minimal score value
-3.4807
Maximal score value
2.9171
Average score
-0.7371
Total score value
-215.9756

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1354
2 P A -0.5963
3 I A 0.0000
4 Q A -1.0070
5 S A -0.6091
6 I A 0.0000
7 K A -2.2904
8 A A 0.0000
9 R A -1.0780
10 Q A 0.1538
11 I A 0.6603
12 Y A 0.9343
13 D A -0.1415
14 S A -1.0176
15 R A -1.3321
16 G A -0.4231
17 N A -0.4588
18 P A 0.0000
19 T A 0.0000
20 V A 0.0000
21 E A -0.5937
22 V A 0.0000
23 D A 0.0000
24 L A 0.0000
25 V A -0.4191
26 T A 0.0000
27 E A -2.3179
28 N A -1.8909
29 G A -0.6341
30 L A 0.5930
31 F A 0.1272
32 R A -0.9970
33 A A 0.0000
34 A A -0.0898
35 V A 0.0000
36 P A -0.2592
37 S A -0.6435
38 G A -0.6640
39 A A -0.5915
40 S A -0.3310
41 T A -0.5542
42 G A -0.5163
43 V A 0.6484
44 H A -1.1611
45 E A -1.9627
46 A A -1.0540
47 L A -0.3845
48 E A -0.4976
49 L A -0.6980
50 R A -1.1684
51 D A -2.0046
52 N A -3.0255
53 D A -3.1338
54 K A -3.4807
55 S A -2.4194
56 K A -2.8618
57 Y A -1.7607
58 H A -2.6479
59 G A 0.0000
60 K A -2.1710
61 S A 0.0000
62 V A 0.0000
63 F A -0.4556
64 K A -1.7954
65 A A 0.0000
66 V A 0.0000
67 D A -2.3601
68 N A -1.4998
69 I A 0.0000
70 N A -1.8388
71 N A -1.7541
72 I A -0.3156
73 I A 0.0000
74 V A -0.9774
75 P A -1.0126
76 E A -1.4213
77 L A 0.0000
78 L A -1.0209
79 K A -1.9310
80 S A -1.3851
81 G A -0.8994
82 L A -0.7325
83 E A -0.9718
84 V A 0.0000
85 T A -0.9919
86 Q A -0.9968
87 Q A 0.0000
88 T A -1.0848
89 D A -1.7806
90 I A 0.0000
91 D A -1.2400
92 N A -1.8977
93 L A -1.2644
94 L A 0.0000
95 L A -1.0023
96 K A -1.7020
97 I A -0.8839
98 D A 0.0000
99 G A -1.2975
100 T A -1.2043
101 P A -0.8215
102 N A -1.6367
103 K A -1.3962
104 A A -1.1082
105 K A -1.7928
106 L A 0.0000
107 G A 0.0000
108 A A -0.2565
109 N A 0.0000
110 A A 0.0000
111 I A 0.0000
112 L A 0.7943
113 G A 0.0000
114 V A 0.0000
115 S A 0.3344
116 L A 0.4165
117 A A 0.0000
118 V A 0.0000
119 C A 0.2646
120 K A -0.1646
121 A A 0.0000
122 G A 0.0000
123 A A 0.0000
124 A A -1.2054
125 K A -2.3012
126 K A -1.6985
127 G A -1.2036
128 I A -0.2811
129 P A 0.2785
130 L A 0.8350
131 Y A 1.6465
132 K A 0.0052
133 Y A 0.0000
134 I A 1.2348
135 A A 0.0000
136 E A -1.3215
137 L A 0.1869
138 A A -0.3882
139 G A -1.2727
140 N A -1.6866
141 S A -1.3849
142 N A -0.8031
143 I A 1.5438
144 V A 2.9171
145 L A 2.7574
146 P A 1.6810
147 V A 1.7916
148 P A 1.1273
149 A A 0.6268
150 F A 0.4020
151 N A -0.2970
152 V A 0.0000
153 I A 0.0000
154 N A 0.0000
155 G A 0.0000
156 G A 0.0000
157 S A -0.7189
158 H A -0.8021
159 A A -0.9046
160 G A -0.9568
161 N A 0.0000
162 K A -1.9222
163 L A 0.0000
164 A A 0.0000
165 M A 0.0000
166 Q A 0.0000
167 E A -0.5391
168 F A 0.0000
169 M A 0.2612
170 I A 0.0000
171 L A 0.7606
172 P A 0.0000
173 L A 0.4109
174 G A -0.7940
175 A A -0.4897
176 A A -0.5251
177 N A -0.6040
178 F A 0.6089
179 T A -0.6090
180 E A -1.2136
181 A A 0.0000
182 M A -0.3524
183 K A -1.7120
184 M A 0.0000
185 G A 0.0000
186 S A -0.8936
187 E A -1.1998
188 V A 0.0000
189 Y A -0.5368
190 H A -0.9917
191 Y A -0.6697
192 L A 0.0000
193 K A -1.3509
194 A A -1.3930
195 G A -2.0307
196 I A 0.0000
197 K A -2.6047
198 K A -3.0064
199 K A -2.5532
200 F A -1.4101
201 G A -1.2409
202 L A -0.3744
203 D A -1.2027
204 A A 0.0000
205 T A 0.0000
206 A A 0.2514
207 V A 0.8053
208 G A -0.6361
209 D A -2.2221
210 E A -1.9056
211 G A -0.6384
212 G A 0.0000
213 F A 0.0000
214 A A -0.4604
215 P A 0.0000
216 N A -1.6669
217 I A 0.0000
218 L A -0.4449
219 E A -2.0599
220 N A 0.0000
221 K A -2.4407
222 E A -1.7659
223 A A 0.0000
224 L A 0.0000
225 N A -1.7375
226 L A 0.0000
227 I A 0.0000
228 I A -1.7164
229 D A -2.6747
230 A A 0.0000
231 I A 0.0000
232 K A -2.9793
233 T A -1.6395
234 A A -1.3593
235 G A -1.9707
236 Y A -2.0151
237 E A -3.2497
238 G A -2.3238
239 K A -1.7448
240 I A 0.0000
241 K A -0.7811
242 I A 0.0000
243 G A 0.0000
244 M A 0.1408
245 D A -0.4649
246 V A -0.2034
247 A A -0.5102
248 A A -0.5810
249 S A -0.8883
250 E A -1.1147
251 F A 0.0000
252 H A -1.6160
253 K A -1.8557
254 N A -2.0336
255 G A -1.7446
256 K A -2.0292
257 Y A -1.0817
258 D A 0.0000
259 L A -0.2909
260 D A -1.4798
261 F A -1.6905
262 K A -2.1075
263 N A -2.9083
264 E A -3.3496
265 K A -3.4026
266 S A -2.6277
267 D A -2.6249
268 P A -1.4932
269 A A -0.5605
270 T A -0.6926
271 Y A -0.8586
272 L A -0.9442
273 E A -2.2685
274 P A -2.3039
275 D A -3.0124
276 A A -1.8900
277 L A 0.0000
278 K A -2.4687
279 N A -2.2425
280 L A -0.9190
281 Y A -0.4965
282 L A -0.4279
283 E A -1.9181
284 W A 0.0000
285 V A -0.0505
286 K A -1.8401
287 G A -1.4363
288 L A -1.1253
289 P A -1.0648
290 H A 0.0000
291 R A -1.5235
292 F A 0.3561
293 Y A 1.1359
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5846 4.2966 View CSV PDB
4.5 -0.6483 4.2966 View CSV PDB
5.0 -0.7205 4.2966 View CSV PDB
5.5 -0.7821 4.2966 View CSV PDB
6.0 -0.8125 4.2966 View CSV PDB
6.5 -0.8008 4.2966 View CSV PDB
7.0 -0.7542 4.2966 View CSV PDB
7.5 -0.688 4.2966 View CSV PDB
8.0 -0.612 4.2966 View CSV PDB
8.5 -0.5285 4.2966 View CSV PDB
9.0 -0.4367 4.2966 View CSV PDB