Project name: bdf13ac2539e8e3 [mutate: SP37B]

Status: done

Started: 2026-06-26 14:28:26
Chain sequence(s) B: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRR
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues SP37B
Energy difference between WT (input) and mutated protein (by FoldX) 5.06401 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:03:22)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/bdf13ac2539e8e3/tmp/folded.pdb                (00:03:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:09)
Show buried residues

Minimal score value
-3.9829
Maximal score value
1.8924
Average score
-0.9697
Total score value
-155.146

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M B -0.1015
2 N B -1.0774
3 I B -0.3983
4 R B -0.7161
5 N B -1.0386
6 A B 0.0000
7 R B -1.9340
8 P B -1.2097
9 E B -2.1406
10 D B 0.0000
11 L B 0.0000
12 M B -0.0912
13 N B -1.1888
14 M B 0.0000
15 Q B -0.1982
16 H B -0.2796
17 C B 0.0000
18 N B 0.0000
19 L B 1.3074
20 L B 1.8924
21 C B 0.8589
22 L B 0.7166
23 P B -0.1617
24 E B -0.9974
25 N B -1.0552
26 Y B -1.0875
27 Q B -1.4594
28 M B -0.6638
29 K B -1.3142
30 Y B -0.1772
31 Y B 0.0000
32 F B 0.7679
33 Y B 1.1218
34 H B 0.0000
35 G B 0.3508
36 L B 1.6922
37 P B 0.8520 mutated: SP37B
38 W B 0.3260
39 P B -0.2605
40 Q B -1.2140
41 L B 0.0000
42 S B 0.0000
43 Y B -0.6436
44 I B 0.0000
45 A B 0.0000
46 E B -1.7590
47 D B -2.3580
48 E B -3.1150
49 N B -3.0371
50 G B -2.7092
51 K B -2.9410
52 I B 0.0000
53 V B 0.0000
54 G B 0.0000
55 Y B 0.0000
56 V B 0.0000
57 L B 0.0000
58 A B 0.0000
59 K B -0.6958
60 M B 0.0000
61 E B -2.4109
62 E B -3.2296
63 D B -3.5107
64 P B -2.9352
65 D B -3.2819
66 D B -2.5990
67 V B -0.9557
68 P B -1.2756
69 H B 0.0000
70 G B 0.0000
71 H B -0.6695
72 I B 0.0000
73 T B -0.1856
74 S B 0.0000
75 L B 0.0000
76 A B 0.0000
77 V B -0.5780
78 K B -1.1136
79 R B -2.7271
80 S B -1.8091
81 H B -1.4801
82 R B -2.3649
83 R B -1.9729
84 L B 0.0902
85 G B -0.7860
86 L B 0.0000
87 A B -0.7787
88 Q B -1.3724
89 K B -1.4637
90 L B 0.0000
91 M B 0.0000
92 D B -1.3815
93 Q B -1.4776
94 A B 0.0000
95 S B 0.0000
96 R B -1.8757
97 A B 0.0000
98 M B 0.0000
99 I B 0.0000
100 E B -2.5218
101 N B -1.7944
102 F B -0.8305
103 N B -1.5010
104 A B 0.0000
105 K B -1.1614
106 Y B -0.8916
107 V B 0.0000
108 S B -0.6436
109 L B 0.0000
110 H B -0.3274
111 V B 0.0000
112 R B -1.4484
113 K B -1.5696
114 S B -1.5867
115 N B -1.9534
116 R B -2.4544
117 A B -1.1321
118 A B -1.0182
119 L B -1.2405
120 H B -1.7344
121 L B -0.7938
122 Y B -0.8142
123 S B -1.4234
124 N B -1.9585
125 T B -1.2332
126 L B 0.0000
127 N B -2.3763
128 F B 0.0000
129 Q B -1.6538
130 I B 0.1748
131 S B -0.6717
132 E B -1.4850
133 V B -0.5527
134 E B -1.3303
135 P B -1.4941
136 K B -2.3331
137 Y B -0.9237
138 Y B -1.2515
139 A B -1.1257
140 D B -2.2054
141 G B -1.9884
142 E B -2.0822
143 D B -1.8174
144 A B 0.0000
145 Y B -0.4499
146 A B 0.0000
147 M B 0.0000
148 K B -1.4356
149 R B -1.6278
150 D B -2.2342
151 L B 0.0000
152 T B -1.9070
153 Q B -2.5230
154 M B -2.2664
155 A B -3.1287
156 D B -3.9829
157 E B -3.8775
158 L B -3.0239
159 R B -3.6470
160 R B -3.6107
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8273 3.2144 View CSV PDB
4.5 -0.9113 3.2144 View CSV PDB
5.0 -1.0102 3.2144 View CSV PDB
5.5 -1.1058 3.2144 View CSV PDB
6.0 -1.1835 3.2144 View CSV PDB
6.5 -1.2359 3.2144 View CSV PDB
7.0 -1.2641 3.2144 View CSV PDB
7.5 -1.2756 3.2143 View CSV PDB
8.0 -1.2764 3.2143 View CSV PDB
8.5 -1.2674 3.2141 View CSV PDB
9.0 -1.2472 3.2135 View CSV PDB