Project name: HS_160

Status: done

Started: 2026-03-20 01:14:26
Chain sequence(s) A: QVQLKESGPGLMAPSQSLSITCTVSGFSLSSYGVHWVRQPPGQGLEWLGVMWAGGITNYNLALMSRLTITKDSSKTQVFLKINSLQTDDTAMYYCARGGTRYFGESYYLDYWGQGTPLTVSS
B: DDIVVTQSPASLAVSLGQSVTISCRTSESVEYYGTSLMQWYQQKPRQPPKLLINGASNVESGVPARFSGSGSGTEFSLNIHPVEEDDIAVYFCQQSRKAPWTFGGGTKLDIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:25)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:48:33)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:48:34)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:48:36)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:48:37)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:48:38)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:48:39)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:48:40)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:48:42)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:48:43)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:48:44)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:48:45)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:48:46)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:48:47)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:48:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:48:54)
Show buried residues

Minimal score value
-2.8707
Maximal score value
1.7614
Average score
-0.5373
Total score value
-125.7228

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4464
2 V A -0.7710
3 Q A -1.7413
4 L A 0.0000
5 K A -2.1787
6 E A 0.0000
7 S A -0.8226
8 G A -0.3581
9 P A 0.0327
10 G A 0.4213
11 L A 1.3842
12 M A 0.3980
13 A A -0.2811
14 P A -1.2663
15 S A -1.2314
16 Q A -1.4551
17 S A -1.4757
18 L A 0.0000
19 S A -0.7891
20 I A 0.0000
21 T A -0.5035
22 C A 0.0000
23 T A -1.1833
24 V A 0.0000
25 S A -1.2016
26 G A -0.9894
27 F A -0.3603
28 S A -0.1834
29 L A 0.0000
30 S A -0.4273
31 S A -0.2753
32 Y A -0.1896
33 G A 0.0000
34 V A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.7716
40 P A -1.1363
41 P A -0.9317
42 G A -1.2396
43 Q A -1.7659
44 G A -1.1137
45 L A 0.0000
46 E A -0.7942
47 W A 0.0000
48 L A 0.0000
49 G A 0.0000
50 V A 0.0000
51 M A 0.0000
52 W A 0.0000
53 A A -0.2106
54 G A -0.1957
55 G A 0.3108
56 I A 1.6039
57 T A 0.6249
58 N A 0.3344
59 Y A 0.5528
60 N A 0.6127
61 L A 1.5838
62 A A 1.0139
63 L A 0.8075
64 M A 1.1393
65 S A 0.1858
66 R A -0.5303
67 L A 0.0000
68 T A -0.4666
69 I A 0.0000
70 T A -0.1778
71 K A -0.9054
72 D A -1.3284
73 S A -1.3402
74 S A -1.3975
75 K A -2.1584
76 T A -1.3841
77 Q A -1.2365
78 V A 0.0000
79 F A -0.1281
80 L A 0.0000
81 K A -1.3435
82 I A 0.0000
83 N A -1.7960
84 S A -1.3643
85 L A 0.0000
86 Q A -2.1276
87 T A -1.5762
88 D A -2.2304
89 D A 0.0000
90 T A -0.7150
91 A A 0.0000
92 M A -0.1672
93 Y A 0.0000
94 Y A 0.0000
95 C A 0.0000
96 A A 0.0000
97 R A 0.0000
98 G A 0.0000
99 G A 0.0000
100 T A -0.0010
101 R A -0.3285
102 Y A 1.3809
103 F A 1.7614
104 G A 0.2193
105 E A -0.5505
106 S A 0.0000
107 Y A -0.4688
108 Y A -0.0496
109 L A 0.0000
110 D A -0.4119
111 Y A 0.0972
112 W A -0.6802
113 G A 0.0000
114 Q A -2.1202
115 G A 0.0000
116 T A 0.0000
117 P A -0.2319
118 L A 0.0000
119 T A 0.0411
120 V A 0.0000
121 S A -0.3684
122 S A -0.2789
1 D B -2.5229
2 D B -2.3616
3 I B 0.0000
4 V B 0.5843
5 V B 0.0000
6 T B -0.3111
7 Q B -0.3539
8 S B -0.5908
9 P B -0.4799
10 A B -0.5817
11 S B -1.0664
12 L B -0.8138
13 A B -0.9924
14 V B -0.7648
15 S B -1.0786
16 L B -0.8544
17 G B -1.1438
18 Q B -1.2763
19 S B -1.2700
20 V B 0.0000
21 T B -0.4740
22 I B 0.0000
23 S B -0.8197
24 C B 0.0000
25 R B -1.7627
26 T B 0.0000
27 S B -1.3448
28 E B -2.4270
29 S B -1.9173
30 V B 0.0000
31 E B -1.4659
32 Y B 0.0124
33 Y B 0.9393
34 G B -0.0971
35 T B -0.2834
36 S B 0.0000
37 L B 0.0000
38 M B 0.0000
39 Q B 0.0000
40 W B 0.0000
41 Y B 0.0000
42 Q B 0.0000
43 Q B 0.0000
44 K B -1.6844
45 P B -1.5468
46 R B -2.7302
47 Q B -2.6003
48 P B -1.6439
49 P B 0.0000
50 K B -1.6661
51 L B 0.0000
52 L B 0.0000
53 I B 0.0000
54 N B -0.6879
55 G B -0.7799
56 A B 0.0000
57 S B -0.9823
58 N B -1.2976
59 V B -0.3325
60 E B -0.5700
61 S B -0.5190
62 G B -0.4689
63 V B -0.2653
64 P B -0.1680
65 A B -0.2568
66 R B -0.8522
67 F B 0.0000
68 S B -0.6540
69 G B -0.6860
70 S B -1.0563
71 G B -1.3098
72 S B -1.4761
73 G B -1.6758
74 T B -2.1139
75 E B -2.6441
76 F B 0.0000
77 S B -0.9468
78 L B 0.0000
79 N B -0.8968
80 I B 0.0000
81 H B -1.7018
82 P B -1.4469
83 V B 0.0000
84 E B -2.2668
85 E B -2.8707
86 D B -2.6832
87 D B 0.0000
88 I B -1.0505
89 A B 0.0000
90 V B -0.7524
91 Y B 0.0000
92 F B 0.0000
93 C B 0.0000
94 Q B 0.0000
95 Q B 0.0000
96 S B 0.0000
97 R B -1.9663
98 K B -2.5153
99 A B -1.3515
100 P B 0.0000
101 W B 0.0000
102 T B -0.3222
103 F B 0.1718
104 G B 0.0000
105 G B -0.9228
106 G B 0.0000
107 T B 0.0000
108 K B -1.9607
109 L B 0.0000
110 D B -2.1627
111 I B -1.4958
112 K B -1.7477
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5373 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
input -0.5373 View CSV PDB
model_8 -0.5527 View CSV PDB
model_0 -0.5575 View CSV PDB
model_10 -0.5691 View CSV PDB
model_5 -0.5724 View CSV PDB
model_3 -0.5953 View CSV PDB
model_11 -0.5957 View CSV PDB
CABS_average -0.5976 View CSV PDB
model_9 -0.6015 View CSV PDB
model_4 -0.6065 View CSV PDB
model_6 -0.6122 View CSV PDB
model_2 -0.6124 View CSV PDB
model_7 -0.645 View CSV PDB
model_1 -0.6509 View CSV PDB