Project name: ok 2

Status: done

Started: 2026-03-17 06:53:33
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCSASQSVSYMNWYQQKPGQAPRLLIYDTSNLATGIPARFSGSGSGRDFTLTISSLEPEDFAVYYCQQWSNNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNRYTMHWVRQAPGQGLWMGYINPSRGYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/bf2a03948f1e513/tmp/folded.pdb                (00:01:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:20)
Show buried residues

Minimal score value
-3.5556
Maximal score value
0.9876
Average score
-0.7792
Total score value
-186.2372

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9512
2 I A 0.0000
3 V A 0.9876
4 L A 0.0000
5 T A -0.0328
6 Q A 0.0000
7 S A -0.4160
8 P A -0.2902
9 A A -0.3399
10 T A -0.5128
11 L A -0.4544
12 S A -0.9983
13 L A -1.2800
14 S A -1.6490
15 P A -1.7998
16 G A -1.9477
17 E A -2.5794
18 R A -2.8190
19 A A 0.0000
20 T A -0.6537
21 L A 0.0000
22 S A -0.6305
23 C A 0.0000
24 S A -1.3905
25 A A 0.0000
26 S A -0.9855
27 Q A -2.0606
28 S A -2.0170
29 V A 0.0000
30 S A -0.8430
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 Q A -0.4735
37 Q A 0.0000
38 K A -1.5446
39 P A -1.1615
40 G A -1.4225
41 Q A -2.0505
42 A A -1.2303
43 P A 0.0000
44 R A -0.6844
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.3536
49 D A -1.0147
50 T A -0.6415
51 S A -0.6578
52 N A -0.5683
53 L A 0.2047
54 A A 0.0000
55 T A -0.1929
56 G A -0.4354
57 I A 0.0250
58 P A -0.0835
59 A A -0.0777
60 R A -0.7343
61 F A 0.0000
62 S A -0.3120
63 G A 0.0000
64 S A -0.9268
65 G A -1.4429
66 S A -1.5443
67 G A -1.9995
68 R A -3.2178
69 D A -3.0664
70 F A 0.0000
71 T A -0.7119
72 L A 0.0000
73 T A -0.6291
74 I A 0.0000
75 S A -1.5586
76 S A -1.9235
77 L A 0.0000
78 E A -2.5700
79 P A -1.9915
80 E A -2.7298
81 D A 0.0000
82 F A -1.2028
83 A A 0.0000
84 V A -0.4611
85 Y A 0.0000
86 Y A -0.1336
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.3458
91 S A -0.6515
92 N A -1.9717
93 N A -2.0904
94 P A -1.6827
95 F A 0.0000
96 T A -0.1960
97 F A 0.2853
98 G A 0.0000
99 Q A -0.9283
100 G A 0.0000
101 T A 0.0000
102 K A -1.1211
103 L A 0.0000
104 E A -1.7075
105 I A -1.1747
106 K A -2.1061
107 G A -1.6046
108 G A -1.4410
109 G A -1.3406
110 G A -1.4195
111 S A -0.9660
112 G A -1.6386
113 G A -1.6273
114 G A -1.8134
115 G A -1.6545
116 S A -1.1989
117 G A -1.4393
118 G A -1.2111
119 G A -1.3521
120 G A -1.4402
121 S A -1.3880
122 Q A -1.8081
123 V A 0.0000
124 Q A -1.5583
125 L A 0.0000
126 V A 0.2478
127 Q A 0.0000
128 S A -0.6519
129 G A -0.7104
130 A A -0.2659
131 E A -0.5626
132 V A 0.6926
133 K A -0.9832
134 K A -2.1052
135 P A -2.1561
136 G A -1.4800
137 A A -1.1782
138 S A -1.3414
139 V A 0.0000
140 K A -2.1803
141 V A 0.0000
142 S A -0.6654
143 C A 0.0000
144 K A -1.0247
145 A A 0.0000
146 S A -0.8223
147 G A -0.9189
148 Y A -0.6510
149 T A -0.6888
150 F A 0.0000
151 N A -1.8366
152 R A -2.2428
153 Y A -1.1500
154 T A -0.5722
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.3781
161 A A -0.7478
162 P A -0.7941
163 G A -1.2624
164 Q A -1.2959
165 G A -0.6198
166 L A -0.3687
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.1597
171 I A 0.0000
172 N A -0.9210
173 P A 0.0000
174 S A -1.6303
175 R A -1.8113
176 G A -0.8900
177 Y A 0.4021
178 T A 0.1224
179 N A -0.4614
180 Y A -1.3482
181 N A 0.0000
182 Q A -2.9797
183 K A -2.9881
184 F A 0.0000
185 K A -3.5556
186 D A -3.1916
187 R A -2.1771
188 V A 0.0000
189 T A -1.1390
190 M A 0.0000
191 T A -0.5194
192 R A -1.5303
193 D A -1.2653
194 T A -0.8692
195 S A -0.5871
196 T A -0.7289
197 S A -0.9034
198 T A 0.0000
199 V A 0.0000
200 Y A -0.8162
201 M A 0.0000
202 E A -1.6353
203 L A 0.0000
204 S A -1.2797
205 S A -1.2042
206 L A 0.0000
207 R A -2.8718
208 S A -2.2879
209 E A -2.4878
210 D A 0.0000
211 T A -0.9011
212 A A 0.0000
213 V A 0.1325
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.0673
221 D A -2.4353
222 D A -2.5155
223 H A -1.4328
224 Y A -0.4533
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.1306
229 W A -0.3124
230 G A 0.0000
231 Q A -1.3384
232 G A -0.6415
233 T A 0.0000
234 T A -0.0786
235 V A 0.0000
236 T A -0.4061
237 V A 0.0000
238 S A -0.8534
239 S A -0.9189
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7186 1.6015 View CSV PDB
4.5 -0.7611 1.6015 View CSV PDB
5.0 -0.8119 1.6015 View CSV PDB
5.5 -0.8621 1.6015 View CSV PDB
6.0 -0.9021 1.6015 View CSV PDB
6.5 -0.925 1.6015 View CSV PDB
7.0 -0.9299 1.6015 View CSV PDB
7.5 -0.9223 1.6015 View CSV PDB
8.0 -0.9076 1.6015 View CSV PDB
8.5 -0.8874 1.6015 View CSV PDB
9.0 -0.8609 1.6169 View CSV PDB