Project name: c027bed15384b03 [mutate: GA252A] [mutate: RH383A]

Status: done

Started: 2026-03-26 15:12:43
Chain sequence(s) A: MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues RH383A
Energy difference between WT (input) and mutated protein (by FoldX) 1.84607 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:03:23)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c027bed15384b03/tmp/folded.pdb                (00:03:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:46)
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:03:59)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c027bed15384b03/tmp/folded.pdb                (00:04:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:31)
Show buried residues

Minimal score value
-4.1133
Maximal score value
2.3071
Average score
-0.8946
Total score value
-357.8479

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1399
2 N A -1.2023
3 G A -1.3394
4 Q A -1.6591
5 L A -0.8695
6 D A -1.8459
7 L A -1.2745
8 S A -1.2040
9 G A -2.0238
10 K A -2.2549
11 L A 0.0000
12 I A 0.0000
13 I A 0.0000
14 K A -1.5745
15 A A 0.0000
16 Q A -0.8260
17 L A -0.6258
18 G A -1.1517
19 E A -1.7582
20 D A -0.6892
21 I A 0.2281
22 R A -1.1090
23 R A -2.0800
24 I A -0.9172
25 P A -1.1059
26 I A 0.0000
27 H A -2.5922
28 N A -3.3554
29 E A -3.8738
30 D A -3.1137
31 I A -2.3274
32 T A -1.9401
33 Y A -1.2529
34 D A -2.2433
35 E A -1.8322
36 L A 0.0000
37 V A -0.7816
38 L A -0.4051
39 M A -0.7095
40 M A 0.0000
41 Q A -1.2903
42 R A -1.9068
43 V A -1.4091
44 F A 0.0000
45 R A -2.7877
46 G A -2.0350
47 K A -2.2986
48 L A 0.0000
49 L A -0.3764
50 S A -0.8223
51 N A -1.5555
52 D A -1.6889
53 E A -2.2684
54 V A -0.8066
55 T A -0.3114
56 I A 0.0000
57 K A -0.3631
58 Y A 0.0000
59 K A -2.9377
60 D A -2.9289
61 E A -3.5201
62 D A -3.5075
63 G A -2.8557
64 D A -2.7830
65 L A -0.9083
66 I A 0.1426
67 T A 0.2592
68 I A 0.0000
69 F A 1.2972
70 D A -0.6843
71 S A -0.8817
72 S A -0.0949
73 D A 0.1076
74 L A 0.0000
75 S A -0.3710
76 F A 1.3004
77 A A 0.0000
78 I A -0.6942
79 Q A -0.7258
80 C A -0.4769
81 S A -1.2838
82 R A -2.2421
83 I A -1.1311
84 L A 0.0000
85 K A -1.8802
86 L A 0.0000
87 T A -0.3405
88 L A 0.0000
89 F A -0.8433
90 V A -1.2252
91 N A -2.1212
92 G A -1.8872
93 Q A -2.1276
94 P A -1.5243
95 R A -1.8193
96 P A -0.7857
97 L A 0.2900
98 E A -1.0425
99 S A -0.5940
100 S A -0.9081
101 Q A -1.0554
102 V A -0.8821
103 K A -1.9935
104 Y A -0.6048
105 L A -0.6222
106 R A -2.0311
107 R A -2.4702
108 E A -1.6398
109 L A -0.1213
110 I A -0.1375
111 E A -2.2066
112 L A -1.1083
113 R A -2.0644
114 N A -2.2687
115 K A -2.5165
116 V A -1.3015
117 N A -2.1579
118 R A -2.6833
119 L A -0.4775
120 L A -0.1926
121 D A -2.1589
122 S A -0.7437
123 L A 0.2603
124 E A -1.7564
125 P A -1.3915
126 P A -1.6139
127 G A -1.9910
128 E A -2.4426
129 P A -1.6110
130 G A -1.3823
131 P A -1.0609
132 S A -0.6430
133 T A -0.4079
134 N A -0.6782
135 I A 0.6646
136 P A -0.7963
137 E A -2.6429
138 N A -2.8613
139 D A -2.4719
140 T A -0.7193
141 V A 0.3731
142 D A -1.5449
143 G A -2.2301
144 R A -3.7067
145 E A -4.0443
146 E A -3.9606
147 K A -3.0992
148 S A -1.4519
149 A A -0.9103
150 S A -1.1368
151 D A -2.0308
152 S A -1.3256
153 S A -1.3167
154 G A -1.6663
155 K A -2.6012
156 Q A -2.3752
157 S A -1.3852
158 T A -0.4443
159 Q A -0.2581
160 V A 1.6814
161 M A 1.6954
162 A A 1.0431
163 A A 0.8286
164 S A 0.7022
165 M A 1.3649
166 S A 0.4551
167 A A 0.6744
168 F A 1.7397
169 D A 0.2471
170 P A -0.3644
171 L A 0.1702
172 K A -1.8511
173 N A -2.4827
174 Q A -3.3314
175 D A -4.1133
176 E A -4.0615
177 I A -2.3372
178 N A -3.1609
179 K A -3.5318
180 N A -2.2922
181 V A -0.1739
182 M A 0.2088
183 S A -0.0308
184 A A 0.7057
185 F A 2.3071
186 G A 0.9786
187 L A 1.2745
188 T A -0.7881
189 D A -2.3790
190 D A -2.6392
191 Q A -1.7503
192 V A 0.3321
193 S A 0.0927
194 G A -0.5318
195 P A -0.7099
196 P A -0.5988
197 S A -0.4236
198 A A -0.2499
199 P A -0.6071
200 A A -1.3194
201 E A -3.0762
202 D A -3.6212
203 R A -3.3138
204 S A -1.8303
205 G A -1.0550
206 T A -1.0468
207 P A -1.3398
208 D A -1.6290
209 S A -0.1099
210 I A 1.5118
211 A A 0.9230
212 S A 0.0869
213 S A -0.2484
214 S A -0.4609
215 S A -0.3335
216 A A -0.2618
217 A A -0.4865
218 H A -1.1475
219 P A -0.9853
220 P A -0.5011
221 G A -0.0554
222 V A 0.7673
223 Q A -0.6727
224 P A -1.2797
225 Q A -2.2102
226 Q A -2.0248
227 P A -1.0375
228 P A -0.0467
229 Y A 1.0057
230 T A 0.3595
231 G A -0.4093
232 A A -0.8424
233 Q A -1.5428
234 T A -1.2164
235 Q A -1.6722
236 A A -1.0883
237 G A -0.8732
238 Q A -0.8828
239 I A 0.1317
240 E A -1.5936
241 G A -1.2394
242 Q A -0.8943
243 M A 0.4475
244 Y A 0.7660
245 Q A -0.8585
246 Q A -1.0451
247 Y A -0.3545
248 Q A -1.8264
249 Q A -2.2704
250 Q A -1.8297
251 A A -0.9918
252 G A -0.2254
253 Y A 0.7325
254 G A -0.1551
255 A A -0.7858
256 Q A -2.0162
257 Q A -2.1767
258 P A -1.6861
259 Q A -1.7657
260 A A -0.8945
261 P A -0.8894
262 P A -1.1654
263 Q A -1.9943
264 Q A -2.1976
265 P A -1.9831
266 Q A -1.8625
267 Q A -1.0698
268 Y A 0.6732
269 G A 0.7783
270 I A 1.6157
271 Q A 0.3184
272 Y A 0.9936
273 S A 0.1050
274 A A 0.3581
275 S A 0.3410
276 Y A 0.8536
277 S A -0.3397
278 Q A -1.7134
279 Q A -2.0407
280 T A -1.1906
281 G A -1.1200
282 P A -1.3171
283 Q A -2.0506
284 Q A -2.2060
285 P A -1.9469
286 Q A -1.7431
287 Q A -1.1279
288 F A 0.4076
289 Q A -0.5136
290 G A -0.1180
291 Y A 0.3380
292 G A -0.6316
293 Q A -1.7739
294 Q A -2.0161
295 P A -1.2014
296 T A -0.8464
297 S A -0.8974
298 Q A -1.3436
299 A A -0.7720
300 P A -0.5078
301 A A -0.1665
302 P A 0.1333
303 A A 0.8958
304 F A 1.7247
305 S A 0.2452
306 G A -0.7908
307 Q A -1.8122
308 P A -1.7993
309 Q A -1.7956
310 Q A -1.1332
311 L A 0.5970
312 P A -0.0071
313 A A -0.5433
314 Q A -1.5403
315 P A -1.3999
316 P A -1.3532
317 Q A -1.8962
318 Q A -1.5473
319 Y A -0.2019
320 Q A -1.2099
321 A A -0.5970
322 S A -0.6565
323 N A -0.9374
324 Y A 0.4078
325 P A -0.2066
326 A A -0.3262
327 Q A -0.7928
328 T A -0.0383
329 Y A 0.8253
330 T A 0.1052
331 A A -0.2530
332 Q A -1.2346
333 T A -0.9934
334 S A -1.1547
335 Q A -1.5811
336 P A -1.1625
337 T A -0.7966
338 N A -0.7077
339 Y A 1.0092
340 T A 1.1932
341 V A 1.9978
342 A A 0.7798
343 P A 0.1643
344 A A -0.4155
345 S A -0.8599
346 Q A -1.5165
347 P A -0.9666
348 G A -0.3193
349 M A 0.7542
350 A A 0.2898
351 P A -0.3330
352 S A -1.0259
353 Q A -1.5852
354 P A -1.1284
355 G A -0.5098
356 A A 0.2157
357 Y A 0.6080
358 Q A -1.0054
359 P A -1.5161
360 R A -2.4044
361 P A -1.0285
362 G A 0.0533
363 F A 1.5678
364 T A 0.9423
365 S A 0.8346
366 L A 1.2081
367 P A 0.1558
368 G A -0.2493
369 S A -0.1916
370 T A 0.1440
371 M A 0.7529
372 T A 0.1766
373 P A -0.2374
374 P A -0.4968
375 P A -0.7110
376 S A -0.9639
377 G A -1.1767
378 P A -1.0552
379 N A -1.3659
380 P A -0.6729
381 Y A 0.2979
382 A A -0.9431
383 H A -1.9124 mutated: RH383A
384 N A -2.5770
385 R A -2.6108
386 P A -1.2059
387 P A -0.3374
388 F A 0.8671
389 G A -0.1724
390 Q A -0.8897
391 G A -0.3880
392 Y A 0.4264
393 T A -0.2612
394 Q A -1.2556
395 P A -1.0498
396 G A -1.1578
397 P A -0.8127
398 G A -0.5431
399 Y A 0.1425
400 R A -1.3558
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis. The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.0049 5.0294 View CSV PDB
4.5 -0.0725 5.0294 View CSV PDB
5.0 -0.1574 5.0294 View CSV PDB
5.5 -0.2465 5.0294 View CSV PDB
6.0 -0.3259 5.0294 View CSV PDB
6.5 -0.3845 5.0294 View CSV PDB
7.0 -0.4204 5.0294 View CSV PDB
7.5 -0.4401 5.0294 View CSV PDB
8.0 -0.4499 5.0294 View CSV PDB
8.5 -0.4509 5.0294 View CSV PDB
9.0 -0.4416 5.0294 View CSV PDB