Project name: AAAV_R4

Status: done

Started: 2026-08-21 08:49:22
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:19)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c0382ddd48e4278/tmp/folded.pdb                (00:02:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:36)
Show buried residues

Minimal score value
-2.6677
Maximal score value
1.991
Average score
-0.5422
Total score value
-134.4608

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6081
2 V A -1.3049
3 Q A -1.9771
4 L A 0.0000
5 Q A -1.8588
6 E A 0.0000
7 S A -0.7081
8 G A -0.3944
9 P A 0.0357
10 G A 0.3817
11 L A 0.9727
12 V A 0.0000
13 K A -1.8449
14 P A -1.3607
15 S A -1.4759
16 Q A -2.0524
17 T A -1.7233
18 L A 0.0000
19 S A -1.0431
20 L A 0.0000
21 T A -0.6467
22 A A 0.0000
23 T A -1.2579
24 V A 0.0000
25 S A -1.3343
26 G A -1.3360
27 G A -1.0423
28 S A -0.7044
29 I A 0.0000
30 S A -0.2479
31 S A -0.3280
32 G A -0.1663
33 D A 0.1338
34 Y A 0.7015
35 Y A 0.6759
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.2184
41 Q A 0.0000
42 P A -0.7786
43 P A -0.6860
44 G A -1.1339
45 C A -1.2471
46 K A -2.0744
47 G A -1.2921
48 L A 0.0000
49 E A -0.7972
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1279
54 I A 0.0000
55 Y A 0.3580
56 Y A 0.3388
57 S A -0.1103
58 G A -0.2569
59 S A -0.2614
60 T A -0.2671
61 D A -0.7513
62 Y A -0.7623
63 N A -0.9132
64 P A -1.1204
65 S A -1.0885
66 L A 0.0000
67 K A -2.1214
68 S A -1.4510
69 R A -1.7335
70 V A 0.0000
71 T A -1.1716
72 M A 0.0000
73 S A -0.4322
74 V A -0.4138
75 D A -1.2889
76 T A -1.0935
77 S A -1.3560
78 K A -2.2022
79 N A -1.4685
80 Q A -1.3069
81 F A 0.0000
82 S A -0.5932
83 L A 0.0000
84 K A -1.7305
85 V A 0.0000
86 N A -1.9413
87 S A -1.6385
88 V A 0.0000
89 T A -0.6982
90 A A -0.4062
91 A A -0.2914
92 D A 0.0000
93 T A 0.2682
94 A A 0.0000
95 V A 0.1829
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.4939
104 F A 1.9910
105 G A 0.7600
106 V A 0.7308
107 G A 0.7406
108 T A 0.0000
109 F A 0.0000
110 D A -0.4616
111 Y A -0.5441
112 W A -0.8180
113 G A 0.0000
114 Q A -1.6412
115 G A -0.7770
116 T A -0.2037
117 L A 0.8372
118 V A 0.0000
119 T A 0.3614
120 V A 0.0000
121 S A -0.3742
122 S A -0.7862
123 A A -0.6666
124 A A -0.3662
125 G A -0.8422
126 G A -1.0821
127 G A -1.1522
128 G A -1.1822
129 S A -1.0042
130 G A -1.1678
131 G A -1.1931
132 G A -1.3979
133 G A -1.2167
134 S A -0.9063
135 G A -1.2701
136 G A -1.1253
137 G A -1.3007
138 G A -0.9439
139 S A -0.8575
140 D A -0.8253
141 I A 0.0000
142 V A 0.8497
143 M A 0.0000
144 T A -0.6106
145 Q A -0.6509
146 S A -0.6992
147 P A -0.3293
148 A A -0.3289
149 T A -0.4214
150 L A -0.1610
151 S A -0.3347
152 L A -0.6519
153 S A -0.9738
154 P A -1.4360
155 G A -1.7823
156 E A -2.3682
157 R A -2.6677
158 A A 0.0000
159 T A -0.6603
160 L A 0.0000
161 S A -0.8913
162 A A 0.0000
163 R A -2.3836
164 A A 0.0000
165 S A -0.8850
166 Q A -1.5924
167 S A -1.2412
168 V A 0.0000
169 S A -0.4021
170 S A -0.0926
171 Y A 0.9140
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4084
179 P A -0.8982
180 G A -0.9904
181 C A -1.1340
182 Q A -1.5857
183 A A -1.2133
184 P A 0.0000
185 R A -1.5653
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2696
190 D A -0.3398
191 A A 0.0000
192 S A -0.8971
193 N A -1.2833
194 R A -1.5172
195 A A -0.9876
196 T A -0.6815
197 G A -0.6772
198 I A 0.0000
199 P A -0.4516
200 A A -0.3820
201 R A -0.6950
202 F A 0.0000
203 S A -0.6612
204 G A -0.7011
205 S A -0.8024
206 G A -1.1398
207 S A -0.9372
208 G A -1.0611
209 T A -1.7904
210 D A -2.2442
211 F A 0.0000
212 T A -0.7964
213 L A 0.0000
214 T A -0.5859
215 I A 0.0000
216 S A -1.3299
217 S A -1.7125
218 L A 0.0000
219 E A -2.1364
220 P A -1.3395
221 E A -2.0842
222 D A 0.0000
223 F A -0.6037
224 A A 0.0000
225 V A -0.5617
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3480
232 G A 0.0894
233 S A -0.1523
234 T A -0.3620
235 P A 0.0000
236 L A 0.0000
237 T A 0.2142
238 F A 0.2517
239 G A 0.0000
240 G A -0.7965
241 G A -0.7514
242 T A 0.0000
243 K A -0.6866
244 A A 0.0000
245 E A -0.3446
246 I A 0.7490
247 K A -0.8788
248 A A -0.3477
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.515 4.8617 View CSV PDB
4.5 -0.5331 4.8592 View CSV PDB
5.0 -0.5541 4.8522 View CSV PDB
5.5 -0.5725 4.8362 View CSV PDB
6.0 -0.5818 4.8088 View CSV PDB
6.5 -0.5778 4.7731 View CSV PDB
7.0 -0.5614 4.7336 View CSV PDB
7.5 -0.537 4.6926 View CSV PDB
8.0 -0.5082 4.6512 View CSV PDB
8.5 -0.4764 4.6097 View CSV PDB
9.0 -0.4424 4.5684 View CSV PDB