Project name: 52859164a3792f3 [mutate: PL209A]

Status: done

Started: 2026-04-16 16:23:22
Chain sequence(s) A: MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLSHIMAQPLCIRALLNLHT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues PL209A
Energy difference between WT (input) and mutated protein (by FoldX) -0.556742 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:12)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:12)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:12)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:12)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:12)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:12)
[INFO]       FoldX:    Building mutant model                                                       (00:02:28)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:35)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c0c82f5e00c2ea8/tmp/folded.pdb                (00:02:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:16)
Show buried residues

Minimal score value
-4.3791
Maximal score value
2.8654
Average score
-0.7034
Total score value
-187.8144

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -1.8268
2 E A -2.8712
3 K A -2.8581
4 Y A 0.0000
5 E A -3.3259
6 R A -2.2583
7 I A -0.3872
8 R A -1.1890
9 V A 0.1500
10 V A 1.0190
11 G A -0.3826
12 R A -1.4642
13 G A -0.7407
14 A A 0.1810
15 F A 0.3417
16 G A -0.2416
17 I A -0.0207
18 V A 0.1300
19 H A 0.0000
20 L A 0.0000
21 C A 0.0000
22 L A -1.8141
23 R A -3.0023
24 K A -3.5318
25 A A -2.1705
26 D A -2.7136
27 Q A -2.9190
28 K A -1.9881
29 L A -0.6845
30 V A 0.0000
31 I A 0.0000
32 I A 0.0000
33 K A -0.0626
34 Q A -0.3955
35 I A 0.0000
36 P A -1.5396
37 V A 0.0000
38 E A -3.2831
39 Q A -2.7146
40 M A -2.6452
41 T A -2.8326
42 K A -3.7721
43 E A -3.8633
44 E A -3.6397
45 R A -4.3791
46 Q A -3.6501
47 A A 0.0000
48 A A 0.0000
49 Q A -2.6488
50 N A -2.2964
51 E A -1.5343
52 C A 0.0000
53 Q A -1.5830
54 V A -0.7048
55 L A -1.0656
56 K A -1.8017
57 L A -0.2154
58 L A 0.0000
59 N A -1.5544
60 H A -0.9246
61 P A -0.6443
62 N A 0.0000
63 V A 0.0000
64 I A 0.0000
65 E A -1.1050
66 Y A -0.7922
67 Y A -0.5518
68 E A -1.1226
69 N A -0.7866
70 F A 0.4888
71 L A 0.3828
72 E A -1.5560
73 D A -2.9367
74 K A -3.1994
75 A A 0.0000
76 L A 0.0000
77 M A 0.0000
78 I A 0.0000
79 A A 0.0000
80 M A -0.1024
81 E A -0.1952
82 Y A -0.0787
83 A A 0.0000
84 P A -0.9604
85 G A -1.2651
86 G A -0.8620
87 T A -0.9961
88 L A 0.0000
89 A A -1.5072
90 E A -2.3197
91 F A -1.5848
92 I A 0.0000
93 Q A -2.7683
94 K A -2.7371
95 R A -1.7940
96 C A -0.9091
97 N A -1.6727
98 S A -1.0431
99 L A -0.5945
100 L A 0.0000
101 E A -2.3377
102 E A -2.1392
103 E A -2.8560
104 T A -1.5053
105 I A 0.0000
106 L A 0.0000
107 H A -1.1545
108 F A 0.0000
109 F A 0.0000
110 V A 0.0000
111 Q A 0.0000
112 I A 0.0000
113 L A 0.0000
114 L A 0.0483
115 A A 0.0000
116 L A 0.0000
117 H A -0.3524
118 H A -0.4315
119 V A 0.0000
120 H A 0.0000
121 T A 0.0472
122 H A 0.3333
123 L A 1.1414
124 I A 0.0000
125 L A -0.0550
126 H A 0.0000
127 R A -0.9760
128 D A -1.2441
129 L A 0.0000
130 K A -1.0765
131 T A 0.0000
132 Q A -1.7289
133 N A 0.0000
134 I A 0.0000
135 L A -0.3623
136 L A 0.0000
137 D A 0.0000
138 K A -2.3370
139 H A -1.9564
140 R A -1.3578
141 M A -0.2319
142 V A -0.0382
143 V A 0.0000
144 K A -0.0650
145 I A 0.0000
146 G A 0.0000
147 D A -2.0435
148 F A 0.0000
149 G A 0.0000
150 I A 0.0000
151 S A -0.9394
152 K A -1.3261
153 I A 0.0370
154 L A -0.3502
155 S A -1.0751
156 S A -1.5040
157 K A -2.1321
158 S A -1.5327
159 K A -1.9477
160 A A -0.0607
161 Y A 1.6095
162 T A 1.6629
163 V A 2.8654
164 V A 2.4897
165 G A 0.8083
166 T A 0.0499
167 P A 0.1300
168 C A 0.0000
169 Y A -0.0374
170 I A 0.7717
171 S A 0.0000
172 P A 0.0000
173 E A 0.0000
174 L A -0.9492
175 C A -0.5072
176 E A -2.2445
177 G A -2.1442
178 K A -2.2784
179 P A -1.2605
180 Y A -0.5151
181 N A -1.1471
182 Q A -1.0691
183 K A -1.2312
184 S A 0.0000
185 D A 0.0000
186 I A 0.0000
187 W A 0.0000
188 A A 0.0000
189 L A 0.0000
190 G A 0.0000
191 C A 0.0000
192 V A 0.0000
193 L A 0.0000
194 Y A 0.0000
195 E A 0.0000
196 L A 0.0000
197 A A 0.0000
198 S A -0.8232
199 L A -1.4068
200 K A -2.5277
201 R A -1.9312
202 A A 0.0000
203 F A 0.0000
204 E A -2.3805
205 A A -0.8166
206 A A -0.6363
207 N A -0.8604
208 L A 0.7812
209 L A 1.8108 mutated: PL209A
210 A A 0.7322
211 L A 0.0000
212 V A 1.1840
213 L A 1.9504
214 K A 0.1912
215 I A 0.0000
216 M A 0.5250
217 S A 0.2258
218 G A 0.1005
219 T A 0.0193
220 F A -0.1722
221 A A -0.2405
222 P A -0.3826
223 I A 0.0000
224 S A -1.6351
225 D A -2.8651
226 R A -2.9367
227 Y A 0.0000
228 S A -1.6700
229 P A -1.8574
230 E A -1.8655
231 L A 0.0000
232 R A -1.4997
233 Q A -1.4907
234 L A 0.0000
235 V A 0.0000
236 L A 0.5358
237 S A -0.0470
238 L A 0.0000
239 L A 0.0000
240 S A -0.3620
241 L A -0.3641
242 E A -1.6988
243 P A -1.3072
244 A A -1.0394
245 Q A -1.6620
246 R A 0.0000
247 P A -0.7846
248 P A -0.9279
249 L A 0.0000
250 S A -0.7948
251 H A -1.2096
252 I A 0.0000
253 M A -0.3738
254 A A -0.4938
255 Q A -0.9442
256 P A -0.6669
257 L A 0.0000
258 C A 0.0000
259 I A 0.3013
260 R A -1.3760
261 A A -0.9277
262 L A 0.1852
263 L A 0.4655
264 N A -1.1421
265 L A -0.2852
266 H A -0.6264
267 T A -0.3960
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7711 2.9393 View CSV PDB
4.5 -0.8245 2.9393 View CSV PDB
5.0 -0.8878 2.9393 View CSV PDB
5.5 -0.9448 2.9393 View CSV PDB
6.0 -0.9786 2.9393 View CSV PDB
6.5 -0.9782 2.9393 View CSV PDB
7.0 -0.9462 2.9393 View CSV PDB
7.5 -0.8948 2.9392 View CSV PDB
8.0 -0.834 2.9392 View CSV PDB
8.5 -0.7681 2.9389 View CSV PDB
9.0 -0.6987 2.9382 View CSV PDB