Project name: A1teicore_dynamics

Status: done

Started: 2026-08-18 04:27:02
Chain sequence(s) A: STVPELLARQVTRAPDAVAVVDRDRVLTYRELDELAGRLSGRLIGRGVRRGDRVAVLLDRSADLVVTLLAIWKAGAAYVPVDAGYPAPRVAFMVADSGASRMVCSAATRDGVPEGIEAIVVTDAFEASAAGARPGDLAYVMYTSGSTGIPKGVAVPHRSVAELAGNPGWAVEPGDAVLMHAPYAFDASLFEIWVPLVSGGRVVIAEPGPVDARRLREAISSGVTRAHLTAGSFRAVAEESPESFAGLREVLTGGDVVPAHAVARVRSACPRVRIRHLYGPTETTLCATWHLLEPGDEIGPVLPIGRPLPGRRAQVLDASLRAVAPGVIGDLYLSGAGLADGYLRRAGLTAERFVADPSAPGARMYRTGDLAQWTADGALLFAGRADDQGSHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:06:03)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (01:41:55)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (01:41:57)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (01:42:00)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (01:42:02)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (01:42:04)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (01:42:07)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (01:42:09)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (01:42:11)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (01:42:13)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (01:42:16)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (01:42:18)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (01:42:20)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (01:42:23)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (01:42:30)
[INFO]       Main:     Simulation completed successfully.                                          (01:42:33)
Show buried residues

Minimal score value
-3.4554
Maximal score value
1.5426
Average score
-0.6198
Total score value
-242.9729

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
9 S A -0.9938
10 T A -1.2199
11 V A 0.0000
12 P A 0.0000
13 E A -1.3612
14 L A 0.0000
15 L A 0.0000
16 A A -1.7551
17 R A -2.4896
18 Q A 0.0000
19 V A -1.7625
20 T A -1.7735
21 R A -2.5026
22 A A -1.7578
23 P A -1.9323
24 D A -2.0638
25 A A -1.3854
26 V A -0.1953
27 A A 0.0000
28 V A 0.0000
29 V A 0.0950
30 D A -1.5558
31 R A -2.8665
32 D A -2.9035
33 R A -1.4910
34 V A 0.5964
35 L A 0.0000
36 T A -0.7178
37 Y A 0.0000
38 R A -2.3110
39 E A -1.8486
40 L A 0.0000
41 D A 0.0000
42 E A -2.0982
43 L A -1.3462
44 A A 0.0000
45 G A 0.0000
46 R A -2.5283
47 L A 0.0000
48 S A -1.4794
49 G A -1.7266
50 R A -2.2048
51 L A 0.0000
52 I A -0.4651
53 G A -0.9350
54 R A -1.4194
55 G A -1.3993
56 V A 0.0000
57 R A -2.8164
58 R A -3.1734
59 G A -2.4244
60 D A -1.9828
61 R A -1.0129
62 V A 0.0000
63 A A 0.0000
64 V A 0.0000
65 L A 0.0000
66 L A -0.8191
67 D A -1.2593
68 R A -1.9560
69 S A 0.0000
70 A A 0.0000
71 D A 0.0000
72 L A 0.0000
73 V A 0.0000
74 V A 0.0000
75 T A 0.0000
76 L A 0.0000
77 L A 0.0000
78 A A 0.0000
79 I A 0.0000
80 W A 0.0000
81 K A 0.0000
82 A A 0.0000
83 G A 0.0000
84 A A 0.0000
85 A A 0.0000
86 Y A 0.0000
87 V A 0.0000
88 P A 0.0000
89 V A 0.0000
90 D A 0.0000
91 A A -0.2103
92 G A -0.4157
93 Y A 0.1409
94 P A -0.3663
95 A A -0.1277
96 P A -0.2754
97 R A -0.5574
98 V A 0.0000
99 A A 0.1870
100 F A 1.1934
101 M A 0.0000
102 V A 0.0000
103 A A 0.2402
104 D A -0.2081
105 S A 0.0000
106 G A -0.7946
107 A A 0.0000
108 S A -0.8149
109 R A -1.2747
110 M A 0.0000
111 V A 0.0000
112 C A 0.0000
113 S A 0.0000
114 A A -0.8160
115 A A -0.8871
116 T A -1.4120
117 R A -2.3804
118 D A -3.1318
119 G A -1.8119
120 V A -0.9065
121 P A -1.1424
122 E A -2.5528
123 G A -2.0722
124 I A -1.6797
125 E A -2.2467
126 A A -1.4459
127 I A 0.0000
128 V A 0.9983
129 V A 0.0000
130 T A 0.0721
131 D A 0.0000
134 A A 0.0000
135 F A -1.3568
136 E A -1.8622
137 A A 0.0000
138 S A -0.8436
139 A A -0.8406
140 A A -0.5257
141 G A -0.8637
142 A A -0.8645
143 R A -1.8064
144 P A -2.0608
145 G A -2.0455
146 D A -2.2392
147 L A -1.0447
148 A A 0.0000
149 Y A 0.0000
150 V A 0.0000
151 M A 0.0000
152 Y A -0.0029
153 T A 0.0000
154 S A -0.4967
155 G A -0.9025
156 S A -0.9290
157 T A 0.0000
158 G A -1.3965
159 I A 0.0000
160 P A -0.6515
161 K A 0.0000
162 G A 0.0000
163 V A 0.0000
164 A A 0.2338
165 V A 0.0000
166 P A -1.0841
167 H A 0.0000
168 R A -2.3269
169 S A 0.0000
170 V A 0.0000
171 A A 0.0000
172 E A -1.2513
173 L A 0.0000
174 A A 0.0000
175 G A -0.3352
176 N A -0.2554
177 P A 0.0000
178 G A 0.3514
179 W A 1.1946
180 A A 0.0000
181 V A 1.3488
182 E A -0.2970
183 P A -0.7236
184 G A -0.6602
185 D A 0.0000
186 A A 0.0000
187 V A 0.0000
188 L A 0.0742
189 M A 0.0000
190 H A -0.7236
191 A A 0.0000
192 P A -0.2319
193 Y A 0.0000
194 A A -0.1083
195 F A 0.0000
196 D A -0.3412
197 A A -0.2864
198 S A 0.0000
199 L A 0.0000
200 F A 0.0000
201 E A 0.0000
202 I A 0.0000
203 W A 0.0000
204 V A 0.0000
205 P A 0.0000
206 L A 0.0000
207 V A 0.0000
208 S A -0.3905
209 G A -1.0089
210 G A 0.0000
211 R A -0.3318
212 V A 0.0000
213 V A 0.3201
214 I A 0.0000
215 A A -1.2557
216 E A -1.3014
217 P A -0.8019
218 G A -0.7911
219 P A 0.0000
220 V A 0.0000
221 D A -2.1522
222 A A 0.0000
223 R A -3.4554
224 R A -2.7871
225 L A 0.0000
226 R A -3.2514
227 E A -3.1688
228 A A -1.7756
229 I A -1.4154
230 S A -1.2063
231 S A -1.0581
232 G A -0.9975
233 V A 0.0000
234 T A 0.0000
235 R A 0.0000
236 A A 0.0000
237 H A -0.3241
238 L A 0.0000
239 T A -0.6075
240 A A -0.6207
241 G A -0.9545
242 S A -1.0673
243 F A 0.0000
244 R A -2.2452
245 A A -1.9759
246 V A 0.0000
247 A A 0.0000
248 E A -3.1796
249 E A -3.3373
250 S A -2.4601
251 P A -1.9923
252 E A -2.0201
253 S A 0.0000
254 F A 0.0000
255 A A -1.2322
256 G A -1.2214
257 L A 0.0000
258 R A -0.8932
259 E A 0.0000
260 V A 0.0000
261 L A 0.0000
262 T A 0.0000
263 G A -0.2573
264 G A -0.2393
265 D A -0.2212
266 V A 0.6577
267 V A 0.0000
268 P A 0.0000
269 A A 0.0000
270 H A -1.2869
271 A A 0.0000
272 V A 0.0000
273 A A -1.4738
274 R A -1.9958
275 V A 0.0000
276 R A 0.0000
277 S A -1.3144
278 A A -1.1499
279 C A 0.0000
280 P A -1.6882
281 R A -2.6503
282 V A 0.0000
283 R A -1.3511
284 I A 0.0000
285 R A 0.0000
286 H A 0.0000
287 L A 0.0000
288 Y A 0.0000
289 G A -0.2774
290 P A -0.3135
291 T A -0.2207
292 E A 0.0000
293 T A 0.0000
294 T A 0.0000
295 L A 0.0000
296 C A 0.0000
297 A A 0.0000
298 T A 0.0000
299 W A -0.2359
300 H A -0.3534
301 L A -0.0699
302 L A 0.0000
303 E A -2.7557
304 P A -1.9948
305 G A -1.6242
306 D A -1.7866
307 E A -2.8020
308 I A 0.0000
309 G A -1.1473
310 P A -0.5629
311 V A 0.3234
312 L A 0.9341
313 P A 0.0000
314 I A 0.2263
315 G A 0.0000
316 R A -2.2743
317 P A -1.6817
318 L A 0.0000
319 P A -0.9481
320 G A -0.9944
321 R A 0.0000
322 R A -2.3076
323 A A 0.0000
324 Q A -1.0542
325 V A 0.0000
326 L A 0.0932
327 D A 0.3208
328 A A 0.2326
329 S A -0.1423
330 L A 0.3784
331 R A -0.7587
332 A A 0.2480
333 V A 0.8263
334 A A 0.3864
335 P A 0.1641
336 G A -0.0196
337 V A 0.0000
338 I A 1.5426
339 G A 0.0000
340 D A 0.0504
341 L A 0.0000
342 Y A -0.3570
343 L A 0.0000
344 S A 0.0000
345 G A 0.0000
346 A A -1.1061
347 G A -1.0317
348 L A 0.0000
349 A A -0.5360
350 D A 0.0000
351 G A -0.1539
352 Y A 0.0000
353 L A -0.3278
354 R A -1.9730
355 R A -1.9128
356 A A -1.0994
357 G A -1.1979
358 L A -0.9652
359 T A -0.6614
360 A A -0.7431
361 E A -1.5919
362 R A 0.0000
363 F A -0.3016
364 V A -0.1472
365 A A -0.6332
366 D A -1.4341
367 P A -1.1075
368 S A -0.6571
369 A A -0.9933
370 P A -0.9233
371 G A -1.3389
372 A A 0.0000
373 R A -1.9611
374 M A 0.0000
375 Y A 0.0000
376 R A -0.8503
377 T A 0.0000
378 G A -0.4603
379 D A 0.0000
380 L A 0.2112
381 A A 0.0000
382 Q A 0.1898
383 W A 0.3223
384 T A 0.0388
385 A A -0.4928
386 D A -1.8769
387 G A -1.1906
388 A A -0.9141
389 L A 0.0000
390 L A 0.7484
391 F A 0.5719
392 A A 0.3433
393 G A -0.5463
394 R A 0.0000
395 A A -1.3233
396 D A -2.1366
397 D A -2.6900
398 Q A -2.4169
399 G A -2.0237
400 S A -1.9295
401 H A -2.3273
402 H A -2.4401
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.6198 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_3 -0.6198 View CSV PDB
model_7 -0.6338 View CSV PDB
model_5 -0.6526 View CSV PDB
model_1 -0.658 View CSV PDB
model_2 -0.6677 View CSV PDB
model_9 -0.682 View CSV PDB
CABS_average -0.6907 View CSV PDB
model_8 -0.6926 View CSV PDB
model_10 -0.6971 View CSV PDB
model_11 -0.718 View CSV PDB
model_0 -0.7388 View CSV PDB
input -0.7554 View CSV PDB
model_6 -0.7626 View CSV PDB
model_4 -0.7653 View CSV PDB