Project name: c1f78a151480073

Status: done

Started: 2026-05-22 08:20:30
Chain sequence(s) A: SGPAFWGLINPQWTLCSKGRRQSPIDVDPEKLLFDPLLRPLHIDKRQVSGTLRNTGQTLMFTVDKNSKHPVNISGGPLAYRYQFEEMYFHYGGDNMHGSEHRIHGYTFPGEIHLYGFNVDLYKNMSEAQHKSQGIVGISIMLQIRENPTEELRMITSTFNQIKFKGSATHIEHLSLQRLLPNTDHYMTYEGSTTHPGCWETTVWIIVNKPIYISRQEMYSLRMLMQGPKEEPAPLENNVRPPQHL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:54)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c1f78a151480073/tmp/folded.pdb                (00:03:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:50)
Show buried residues

Minimal score value
-3.6688
Maximal score value
2.6737
Average score
-0.8034
Total score value
-196.825

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A 0.5711
2 G A 0.1226
3 P A 0.4628
4 A A 1.1366
5 F A 2.6460
6 W A 0.0000
7 G A 1.2160
8 L A 2.6012
9 I A 2.3717
10 N A 0.7167
11 P A -0.1470
12 Q A -0.8138
13 W A 0.1907
14 T A 0.0688
15 L A -0.6400
16 C A 0.0000
17 S A -0.4250
18 K A -2.0291
19 G A -1.8031
20 R A -2.3240
21 R A -1.6718
22 Q A 0.0000
23 S A 0.0000
24 P A 0.0000
25 I A 0.0000
26 D A -1.2105
27 V A 0.0000
28 D A -1.8814
29 P A -1.4075
30 E A -2.3941
31 K A -1.6091
32 L A 0.7786
33 L A 2.1335
34 F A 2.6737
35 D A 1.0806
36 P A 0.6785
37 L A 1.2042
38 L A 0.2936
39 R A -1.8273
40 P A -1.6138
41 L A -1.2519
42 H A -2.0978
43 I A 0.0000
44 D A -2.2928
45 K A -3.1547
46 R A -2.6439
47 Q A -3.0551
48 V A 0.0000
49 S A -2.1844
50 G A 0.0000
51 T A -1.0226
52 L A 0.0000
53 R A -1.4603
54 N A 0.0000
55 T A -1.4123
56 G A -1.9582
57 Q A -1.9106
58 T A 0.0000
59 L A 0.0000
60 M A -0.3140
61 F A 0.0000
62 T A -0.8351
63 V A 0.0000
64 D A -2.4107
65 K A -2.9045
66 N A -2.9329
67 S A -2.6742
68 K A -2.8735
69 H A -2.4414
70 P A -1.9215
71 V A 0.0000
72 N A -1.4046
73 I A 0.0000
74 S A -1.2447
75 G A -1.0472
76 G A -0.9000
77 P A -0.0060
78 L A -0.4381
79 A A -0.2058
80 Y A -0.3920
81 R A -1.6921
82 Y A 0.0000
83 Q A -0.9153
84 F A 0.0000
85 E A -1.0448
86 E A -0.4982
87 M A 0.0000
88 Y A 0.0314
89 F A 0.0000
90 H A 0.0000
91 Y A 0.0000
92 G A 0.0000
93 G A -1.4991
94 D A -1.7228
95 N A -1.4186
96 M A 0.0153
97 H A -1.0865
98 G A 0.0000
99 S A 0.0000
100 E A 0.0000
101 H A 0.0000
102 R A -0.8345
103 I A -0.4657
104 H A -1.2377
105 G A -0.3713
106 Y A 0.7602
107 T A 0.0638
108 F A 0.0000
109 P A 0.0000
110 G A 0.0000
111 E A 0.0000
112 I A 0.0000
113 H A 0.0000
114 L A 0.0000
115 Y A 0.0000
116 G A 0.0000
117 F A 0.0000
118 N A 0.0000
119 V A -0.4603
120 D A -0.5766
121 L A 0.1276
122 Y A -0.7574
123 K A -1.9398
124 N A -1.7260
125 M A 0.0000
126 S A -1.3422
127 E A -1.7066
128 A A 0.0000
129 Q A -1.3461
130 H A -1.8031
131 K A -1.6752
132 S A -1.0473
133 Q A -0.9705
134 G A 0.0000
135 I A 0.0000
136 V A 0.0000
137 G A 0.0000
138 I A 0.0000
139 S A 0.0000
140 I A 0.0000
141 M A 0.0000
142 L A 0.0000
143 Q A -1.1887
144 I A -1.9860
145 R A -3.0913
146 E A -3.6688
147 N A -2.8251
148 P A 0.0000
149 T A -1.8793
150 E A -2.5447
151 E A 0.0000
152 L A 0.0000
153 R A -1.9485
154 M A -1.2037
155 I A 0.0000
156 T A 0.0000
157 S A -0.9640
158 T A 0.0000
159 F A 0.0000
160 N A -2.0578
161 Q A -2.1110
162 I A 0.0000
163 K A -2.2112
164 F A -2.5084
165 K A -2.8008
166 G A -1.6122
167 S A -1.4724
168 A A -1.2071
169 T A -1.0919
170 H A -1.6099
171 I A 0.0000
172 E A -2.7181
173 H A -2.3300
174 L A 0.0000
175 S A 0.0000
176 L A 0.0000
177 Q A -2.9649
178 R A -3.1167
179 L A 0.0000
180 L A -1.1510
181 P A -1.6595
182 N A -2.4102
183 T A -2.1783
184 D A -3.1449
185 H A -2.5737
186 Y A -1.1999
187 M A 0.3930
188 T A 0.1977
189 Y A -0.4716
190 E A -1.5301
191 G A 0.0000
192 S A 0.0000
193 T A 0.0000
194 T A 0.0000
195 H A -0.1979
196 P A 0.1821
197 G A 0.0000
198 C A 0.0000
199 W A -0.3652
200 E A -1.1551
201 T A -1.1478
202 T A 0.0000
203 V A 0.0000
204 W A 0.0000
205 I A 0.0000
206 I A 0.0000
207 V A 0.0000
208 N A -2.2440
209 K A -2.0158
210 P A -0.8426
211 I A 0.0000
212 Y A -1.3638
213 I A 0.0000
214 S A -2.7577
215 R A -2.8753
216 Q A -1.9468
217 E A -1.3259
218 M A 0.0000
219 Y A 0.1516
220 S A -0.3963
221 L A 0.0000
222 R A -0.4077
223 M A 0.1233
224 L A 0.0000
225 M A -1.6828
226 Q A -2.3931
227 G A -2.6035
228 P A -2.9648
229 K A -3.6345
230 E A -3.5862
231 E A -3.4195
232 P A -2.5902
233 A A -1.4542
234 P A -0.9982
235 L A 0.0000
236 E A -1.8283
237 N A -2.1230
238 N A -1.3208
239 V A -0.6545
240 R A 0.0000
241 P A -0.4661
242 P A -0.6938
243 Q A -0.9306
244 H A -0.9035
245 L A 0.2293
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8744 5.8154 View CSV PDB
4.5 -0.9169 5.7402 View CSV PDB
5.0 -0.9666 5.6612 View CSV PDB
5.5 -1.0086 5.5906 View CSV PDB
6.0 -1.0269 5.5906 View CSV PDB
6.5 -1.0149 5.5906 View CSV PDB
7.0 -0.982 5.5906 View CSV PDB
7.5 -0.9413 5.5906 View CSV PDB
8.0 -0.8981 5.5906 View CSV PDB
8.5 -0.8521 5.5906 View CSV PDB
9.0 -0.8019 5.5906 View CSV PDB