Project name: 9afebffc15dbeea [mutate: VQ5A, EV12A, AK23A, YH59A, KS76A, VQ3B, ID33B, LQ42B, FT90B, TH102B] [mutate: QV5A]

Status: done

Started: 2026-05-28 15:59:16
Chain sequence(s) A: EVQLQESGGGLVQPGGSLRLSCKGSGFTFRDYAMTWVRQAPGKGLEWVSSISGSGGNTHYADSVKGRFTISRDNSSNTLYLQMNSLRAEDTAVYYCAKDRLSITIRPRYYGLDVWGQGTTVTVSS
B: DIQMTQSPLSLPVTPGEPASISCRSSQSLLYSDGYNYLDWYQQKSGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGTYYCMQALQTPYHFGQGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues QV5A
Energy difference between WT (input) and mutated protein (by FoldX) 0.131152 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c713c10d6a21730/tmp/folded.pdb                (00:01:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:37)
Show buried residues

Minimal score value
-3.3594
Maximal score value
1.7297
Average score
-0.7114
Total score value
-168.6044

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8588
2 V A -0.8302
3 Q A -1.0720
4 L A 0.0000
5 V A 0.4782 mutated: QV5A
6 E A 0.0000
7 S A -0.7203
8 G A -1.0469
9 G A -0.5007
10 G A 0.1582
11 L A 1.2279
12 V A 0.1668
13 Q A -1.1977
14 P A -1.4253
15 G A -1.2801
16 G A -0.9900
17 S A -1.0054
18 L A -0.8905
19 R A -2.0741
20 L A 0.0000
21 S A -0.5524
22 C A 0.0000
23 K A -0.9546
24 G A -0.8923
25 S A -0.8482
26 G A -0.9697
27 F A -0.5619
28 T A -0.7156
29 F A 0.0000
30 R A -2.2332
31 D A -0.4881
32 Y A -0.3003
33 A A 0.0000
34 M A 0.0000
35 T A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.9055
40 A A -1.2441
41 P A -0.9944
42 G A -1.4655
43 K A -2.4323
44 G A -1.7293
45 L A 0.0000
46 E A -1.4756
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A -0.8544
53 G A 0.0000
54 S A -1.0711
55 G A -1.4438
56 G A -1.2843
57 N A -1.7250
58 T A -0.9808
59 H A -0.9772
60 Y A -0.9816
61 A A -1.4539
62 D A -2.4891
63 S A -1.8078
64 V A 0.0000
65 K A -2.6369
66 G A -1.7667
67 R A -1.4660
68 F A 0.0000
69 T A -0.8358
70 I A 0.0000
71 S A -0.6263
72 R A -1.3089
73 D A -1.9416
74 N A -2.2140
75 S A -1.4136
76 S A -1.4966
77 N A -2.0550
78 T A 0.0000
79 L A 0.0000
80 Y A -0.4712
81 L A 0.0000
82 Q A -1.1126
83 M A 0.0000
84 N A -1.4350
85 S A -1.2375
86 L A 0.0000
87 R A -2.1372
88 A A -1.6303
89 E A -2.1999
90 D A 0.0000
91 T A -0.5766
92 A A 0.0000
93 V A 0.1256
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 K A -0.1433
99 D A 0.0000
100 R A -0.5366
101 L A -0.0363
102 S A 0.3990
103 I A 1.7297
104 T A 1.1810
105 I A 1.6193
109 R A -0.3975
108 P A -0.4616
107 R A -1.2114
106 Y A 0.0000
110 Y A 0.0832
111 G A 0.0000
112 L A 0.0000
113 D A -0.4997
114 V A -0.3245
115 W A -0.4337
116 G A 0.0000
117 Q A -1.2859
118 G A -0.6852
119 T A -0.3100
120 T A 0.0627
121 V A 0.0000
122 T A -0.0323
123 V A 0.0000
124 S A -0.6957
125 S A -0.5311
1 D B -2.4742
2 I B 0.0000
3 Q B -2.1678
4 M B 0.0000
5 T B -1.1762
6 Q B 0.0000
7 S B -0.4893
8 P B -0.3217
9 L B -0.1542
10 S B -0.7406
11 L B -0.6586
12 P B -1.1951
13 V B 0.0000
14 T B -1.8307
15 P B -2.0940
16 G B -2.1479
17 E B -2.5017
18 P B -2.2415
19 A B 0.0000
20 S B -0.6689
21 I B 0.0000
22 S B -0.9665
23 C B 0.0000
24 R B -2.5735
25 S B 0.0000
26 S B -1.7831
27 Q B -1.5964
28 S B -0.4683
29 L B 0.0000
30 L B 1.3669
31 Y B 1.2410
32 S B -0.0787
33 D B -1.4657
34 G B -0.7917
35 Y B 0.4960
36 N B 0.4831
37 Y B 0.0000
38 L B 0.0000
39 D B 0.0000
40 W B 0.0000
41 Y B 0.0000
42 Q B 0.0000
43 Q B -1.0454
44 K B -1.4030
45 S B -0.9525
46 G B -1.4353
47 Q B -2.0426
48 S B -1.3224
49 P B 0.0000
50 Q B -0.9805
51 L B 0.0000
52 L B 0.0000
53 I B 0.0000
54 Y B -0.0951
55 L B 0.2867
56 G B 0.0000
57 S B -0.9407
58 N B -1.1668
59 R B -1.8607
60 A B 0.0000
61 S B -0.7492
62 G B -0.9773
63 V B -1.1170
64 P B -1.4089
65 D B -2.4964
66 R B -2.3144
67 F B 0.0000
68 S B -1.4084
69 G B 0.0000
70 S B -0.9788
71 G B -1.2252
72 S B -0.7593
73 G B -0.4332
74 T B -1.4175
75 D B -2.2476
76 F B 0.0000
77 T B -1.1222
78 L B 0.0000
79 K B -1.7113
80 I B 0.0000
81 S B -2.3072
82 R B -3.3594
83 V B 0.0000
84 E B -2.7491
85 A B -1.7914
86 E B -2.1594
87 D B 0.0000
88 V B -0.8461
89 G B -1.0186
90 T B -0.9335
91 Y B 0.0000
92 Y B 0.0000
93 C B 0.0000
94 M B 0.0000
95 Q B 0.0000
96 A B 0.0000
97 L B 0.2338
98 Q B -1.2774
99 T B -0.9333
100 P B -1.2088
101 Y B 0.0000
102 H B -1.2891
103 F B 0.0000
104 G B 0.0000
105 Q B -1.7206
106 G B -1.1582
107 T B 0.0000
108 K B -1.7781
109 L B 0.0000
110 E B -2.1741
111 I B -2.0183
112 K B -2.1524
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7139 2.0104 View CSV PDB
4.5 -0.7592 1.9975 View CSV PDB
5.0 -0.8125 1.9838 View CSV PDB
5.5 -0.8666 1.9698 View CSV PDB
6.0 -0.9132 1.9556 View CSV PDB
6.5 -0.9448 1.943 View CSV PDB
7.0 -0.9591 1.943 View CSV PDB
7.5 -0.9609 1.943 View CSV PDB
8.0 -0.9549 1.943 View CSV PDB
8.5 -0.9416 1.943 View CSV PDB
9.0 -0.9205 1.943 View CSV PDB