Project name: fold_rfa148_mut8_b3a5b27

Status: done

Started: 2026-06-26 05:03:23
Chain sequence(s) A: EVQLAESGGGLVQPGGSLRLSCAASGFTFSSQGFGWVRQAPGKGLEWVSSISADGSGTYYADSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCARLSRVRVGSTRGVVGDVWGQGTTVTVSS
B: DIAMTQSPLSLPVTPGEPASISCRSSQETSAIGWYLQKPGQSPRLLIYGTSTRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTGVPGTFGQGTKLEIRR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:45)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c756f8960580e62/tmp/folded.pdb                (00:02:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:45)
Show buried residues

Minimal score value
-3.1904
Maximal score value
1.5131
Average score
-0.7828
Total score value
-181.6195

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7515
2 V A -0.4861
3 Q A -1.2288
4 L A 0.0000
5 A A -0.5923
6 E A 0.0000
7 S A -0.8525
8 G A -1.0421
9 G A -0.4263
10 G A 0.2426
11 L A 1.1879
12 V A -0.0414
13 Q A -1.3250
14 P A -1.6327
15 G A -1.4804
16 G A -1.0382
17 S A -1.5154
18 L A -1.1153
19 R A -2.3677
20 L A 0.0000
21 S A -0.7202
22 C A 0.0000
23 A A -0.6650
24 A A 0.0000
25 S A -0.8566
26 G A -0.9085
27 F A -0.3343
28 T A -0.2909
29 F A 0.0000
30 S A -1.2272
31 S A -0.8422
32 Q A -0.9535
33 G A -0.9060
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8201
40 A A -1.2072
41 P A -0.9853
42 G A -1.4513
43 K A -2.3693
44 G A -1.5558
45 L A 0.0000
46 E A -1.0955
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.4672
51 I A 0.0000
52 S A -0.7817
53 A A -1.3221
54 D A -2.2217
55 G A -1.4594
56 S A -0.9172
57 G A -0.4112
58 T A 0.3399
59 Y A 0.9527
60 Y A -0.1534
61 A A 0.0000
62 D A -2.3971
63 S A -1.7768
64 V A 0.0000
65 K A -2.4777
66 G A -1.8510
67 R A -1.8004
68 F A 0.0000
69 T A -0.9397
70 I A 0.0000
71 S A -0.5352
72 R A -1.3449
73 D A -1.7467
74 D A -2.3076
75 S A -1.7863
76 K A -2.4972
77 N A -1.9328
78 T A 0.0000
79 L A 0.0000
80 Y A -0.7007
81 L A 0.0000
82 Q A -1.7305
83 M A 0.0000
84 N A -2.1616
85 S A -1.4795
86 L A 0.0000
87 R A -2.3911
88 A A -1.7390
89 E A -2.2592
90 D A 0.0000
91 T A -0.6393
92 A A 0.0000
93 V A 0.1606
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.3814
99 L A -0.4584
100 S A -0.9193
101 R A -2.5484
102 V A 0.0000
103 R A -2.7577
104 V A -0.9818
105 G A -1.0659
106 S A -1.0953
107 T A -1.7300
108 R A -2.8944
109 G A 0.0000
110 V A -1.0811
111 V A 0.0000
112 G A 0.0000
113 D A -0.5311
114 V A -0.1672
115 W A 0.0000
116 G A 0.0000
117 Q A -1.6092
118 G A -0.7562
119 T A -0.3958
120 T A 0.1038
121 V A 0.0000
122 T A -0.0361
123 V A 0.0000
124 S A -0.7041
125 S A -0.6936
1 D B -1.5111
2 I B -1.0050
3 A B -0.9896
4 M B 0.0000
5 T B -0.9462
6 Q B 0.0000
7 S B -0.2020
8 P B 0.2272
9 L B 0.9730
10 S B 0.0723
11 L B -0.2034
12 P B -1.1701
13 V B 0.0000
14 T B -1.5555
15 P B -1.7088
16 G B -1.7120
17 E B -1.8859
18 P B -1.9988
19 A B 0.0000
20 S B -0.9020
21 I B 0.0000
22 S B -0.9865
23 C B 0.0000
24 R B -2.8492
25 S B 0.0000
26 S B -1.8943
27 Q B -2.7392
28 E B -2.9061
29 T B 0.0000
30 S B -1.3062
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -1.1009
38 K B -1.8155
39 P B -1.1446
40 G B -1.5077
41 Q B -2.1241
42 S B -1.4053
43 P B 0.0000
44 R B -1.0297
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.1443
49 G B -0.7241
50 T B 0.0000
51 S B -0.4271
52 T B -0.4860
53 R B -1.3076
54 A B -0.6910
55 S B -0.6664
56 G B -0.8662
57 V B -0.9502
58 P B -1.2595
59 D B -2.3781
60 R B -2.1900
61 F B 0.0000
62 S B -1.4370
63 G B 0.0000
64 S B -0.9314
65 G B -1.1448
66 S B -1.3213
67 G B -1.7997
68 T B -2.3657
69 D B -2.5354
70 F B 0.0000
71 T B -1.2281
72 L B 0.0000
73 K B -2.1643
74 I B 0.0000
75 S B -2.3498
76 R B -3.1904
77 V B 0.0000
78 E B -2.5073
79 A B -1.4800
80 E B -2.2133
81 D B 0.0000
82 V B -1.0125
83 G B 0.0000
84 V B -0.3532
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B -0.1660
91 T B -0.8568
92 G B -0.0057
93 V B 1.5131
94 P B 0.4285
95 G B 0.2867
96 T B -0.2666
97 F B -0.2550
98 G B 0.0000
99 Q B -1.2336
100 G B 0.0000
101 T B 0.0000
102 K B -0.7578
103 L B 0.0000
104 E B -1.5015
105 I B -1.5075
106 R B -2.1835
107 R B -2.4640
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8298 2.1309 View CSV PDB
4.5 -0.8776 2.0803 View CSV PDB
5.0 -0.9343 2.0069 View CSV PDB
5.5 -0.9914 1.9207 View CSV PDB
6.0 -1.0404 1.8295 View CSV PDB
6.5 -1.0744 1.7365 View CSV PDB
7.0 -1.0919 1.6431 View CSV PDB
7.5 -1.0978 1.6406 View CSV PDB
8.0 -1.0961 1.6406 View CSV PDB
8.5 -1.0877 1.6406 View CSV PDB
9.0 -1.0723 1.6406 View CSV PDB