Project name: KNL1 [mutate: AV2165A] [mutate: AV2165A]

Status: done

Started: 2026-03-30 01:26:53
Chain sequence(s) A: RTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues AV2165A
Energy difference between WT (input) and mutated protein (by FoldX) 1.62789 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:02:37)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:42)
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:02:36)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-4.0119
Maximal score value
2.2468
Average score
-0.8327
Total score value
-178.2007

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
2096 R A -3.0037
2097 T A -2.1461
2098 E A -3.2032
2099 E A -3.2384
2100 L A -1.2295
2101 L A -0.2033
2102 D A -1.9406
2103 Q A -0.3665
2104 L A 1.1538
2105 S A 0.3693
2106 L A 0.1311
2107 S A -0.5973
2108 E A -0.3328
2109 W A -0.1820
2110 D A -0.5472
2111 V A 1.7395
2112 V A 1.8876
2113 E A 0.0755
2114 W A 0.1161
2115 S A -1.4056
2116 D A -2.9929
2117 D A -3.1981
2118 Q A -1.9229
2119 A A 0.0000
2120 V A 0.0000
2121 F A 0.0000
2122 T A -0.1795
2123 F A 0.0000
2124 V A 0.0000
2125 Y A 0.2826
2126 D A -1.0972
2127 T A -0.2795
2128 I A 0.0000
2129 Q A -0.5428
2130 L A 0.0000
2131 T A -0.4704
2132 I A 0.0000
2133 T A -1.2991
2134 F A 0.0000
2135 E A -2.4123
2136 E A -2.4832
2137 S A -0.5405
2138 V A 1.9824
2139 V A 1.7924
2140 G A 0.6319
2141 F A 0.2733
2142 P A 0.6110
2143 F A 2.2468
2144 L A 0.9011
2145 D A -1.2087
2146 K A -2.6365
2147 R A -2.7898
2148 Y A -0.8477
2149 R A 0.0000
2150 K A -1.7608
2151 I A 0.0000
2152 V A 0.0470
2153 D A -0.3804
2154 V A 0.0000
2155 N A -1.0539
2156 F A -0.4453
2157 Q A -0.4899
2158 S A -0.4108
2159 L A 0.3353
2160 L A -0.9739
2161 D A -3.0308
2162 E A -3.5378
2163 D A -3.6864
2164 Q A -3.1015
2165 V A -2.0082 mutated: AV2165A
2166 P A -1.2336
2167 P A -0.8223
2168 S A 0.0000
2169 S A -0.6285
2170 L A -0.8316
2171 L A 0.0000
2172 V A 0.0000
2173 H A 0.0000
2174 K A -1.0157
2175 L A 0.0000
2176 I A 0.0000
2177 F A -1.2704
2178 Q A -1.8557
2179 Y A 0.0000
2180 V A 0.0000
2181 E A -3.7191
2182 E A -3.7260
2183 K A -3.5019
2184 E A -4.0119
2185 S A -2.5731
2186 W A 0.0000
2187 K A -2.2589
2188 K A -2.5416
2189 T A -1.4485
2190 C A -1.3714
2191 T A -0.9845
2192 T A -1.4095
2193 Q A -1.8450
2194 H A -2.6729
2195 Q A -1.8713
2196 L A 0.0000
2197 P A -1.8554
2198 K A -2.7565
2200 L A -1.3658
2201 E A -2.3930
2202 E A -1.5292
2203 F A 0.0000
2204 S A 0.0000
2205 L A 0.1485
2206 V A 0.2396
2207 V A 0.0000
2208 H A 0.0000
2209 H A -0.4351
2210 C A 0.0000
2211 R A -0.4105
2212 L A -0.5321
2213 L A 0.0000
2214 G A 0.0000
2215 E A -1.1356
2216 E A 0.0000
2217 I A 0.0000
2218 E A -1.7892
2219 Y A -1.1874
2220 L A 0.0000
2221 K A -2.7826
2222 R A -2.4580
2223 W A -0.9271
2224 G A 0.0000
2225 P A -1.4258
2226 N A -1.4134
2227 Y A -0.9433
2228 N A -0.7878
2229 L A 0.0000
2231 N A -1.7582
2232 I A 0.0000
2233 D A -1.4341
2234 I A -0.9974
2235 N A -1.6612
2236 N A -1.9133
2237 N A -1.2031
2238 E A -1.1893
2239 L A 0.0000
2240 R A -1.0541
2241 L A 0.0000
2242 L A -0.8212
2243 F A 0.0000
2244 S A -0.3639
2245 S A 0.2590
2246 S A 0.4913
2247 A A 0.4836
2248 A A 0.4465
2249 F A 1.6202
2250 A A 0.0000
2251 K A -0.8139
2252 F A 0.0000
2253 E A 0.0000
2254 I A 0.0000
2255 T A 0.0000
2256 L A 0.0000
2257 F A 0.2337
2258 L A 0.0000
2259 S A 0.1827
2260 A A 0.0000
2261 Y A 0.8742
2262 Y A 0.0000
2263 P A 0.0000
2264 S A -0.1689
2265 V A 0.5282
2266 P A 0.2245
2267 L A 0.0000
2268 P A -0.0041
2269 S A -0.1288
2270 T A -0.4230
2271 I A -0.9438
2272 Q A -1.6611
2273 N A -1.8315
2274 H A -1.1052
2275 V A -0.2631
2276 G A -0.5072
2277 N A -1.5735
2278 T A 0.0000
2279 S A -1.9299
2280 Q A -2.1679
2281 D A -2.6388
2282 D A -2.4777
2283 I A 0.0000
2284 A A -1.4754
2285 T A -1.4794
2286 I A 0.0000
2287 L A 0.0000
2288 S A -1.0549
2289 K A -1.9088
2290 V A 0.0000
2291 P A -1.1437
2292 L A -0.7271
2293 E A -1.9661
2294 N A -1.5691
2295 N A -1.3250
2296 Y A 0.0000
2297 L A 0.0000
2298 K A -1.0670
2299 N A -1.7537
2300 V A 0.0000
2301 V A 0.0000
2302 K A -1.7489
2303 Q A -1.9280
2304 I A 0.0000
2305 Y A -1.8117
2306 Q A -2.8911
2307 D A -3.1275
2308 L A -1.6144
2309 F A -1.3701
2310 Q A -2.7402
2311 D A -2.8749
Download PDB file
View in 3Dmol