Project name: bba71ffce35f6c [mutate: FH101A, LV11A] [mutate: VI11A]

Status: done

Started: 2026-08-12 06:19:42
Chain sequence(s) A: QVKLQESGGGVVQPGGSLKLSCAASGFTFSNYGMSWVRQTPDKRLEFVANINGNGGKTYYPGSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRVAHDGYYDDFWGQGTTVTVSSGGGGSGGGGSGGGGSDIELTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPPTFGGGTKLEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues VI11A
Energy difference between WT (input) and mutated protein (by FoldX) -0.384955 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:05)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:08)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/c979bbde867b9f1/tmp/folded.pdb                (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)
Show buried residues

Minimal score value
-3.7187
Maximal score value
1.6126
Average score
-0.8292
Total score value
-199.8413

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5108
2 V A -0.8530
3 K A -1.5419
4 L A 0.0000
5 Q A -1.2281
6 E A 0.0000
7 S A -0.8305
8 G A -0.8608
9 G A -0.2813
10 G A 0.5050
11 I A 1.6126 mutated: VI11A
12 V A 0.0000
13 Q A -1.4090
14 P A -1.6230
15 G A -1.3271
16 G A 0.0000
17 S A -1.0757
18 L A -0.7623
19 K A -1.8025
20 L A 0.0000
21 S A -0.6069
22 C A 0.0000
23 A A -0.8116
24 A A 0.0000
25 S A -1.1231
26 G A -1.0176
27 F A -0.5618
28 T A -0.5533
29 F A 0.0000
30 S A -1.4769
31 N A -1.8269
32 Y A -1.3511
33 G A -1.3672
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A -2.2429
41 P A -2.1564
42 D A -3.3201
43 K A -3.7187
44 R A -3.5585
45 L A 0.0000
46 E A -1.5041
47 F A 0.0000
48 V A 0.0000
49 A A 0.0000
50 N A -0.2158
51 I A 0.0000
52 N A -1.7961
53 G A -1.9713
54 N A -2.3881
55 G A -1.9244
56 G A -1.9156
57 K A -2.2829
58 T A -0.8813
59 Y A 0.0248
60 Y A -0.2704
61 P A -0.9104
62 G A -1.5211
63 S A -1.3798
64 V A 0.0000
65 K A -2.1339
66 G A -1.5571
67 R A -1.3433
68 F A 0.0000
69 T A -0.7687
70 I A 0.0000
71 S A -0.6406
72 R A -1.1483
73 D A -1.5583
74 N A -1.9272
75 A A -1.3253
76 K A -2.2244
77 N A -1.6107
78 T A -1.1121
79 L A 0.0000
80 Y A -0.3031
81 L A 0.0000
82 Q A -1.2206
83 M A 0.0000
84 S A -1.0255
85 S A -1.0188
86 L A 0.0000
87 K A -2.3557
88 S A -1.9368
89 E A -2.3911
90 D A 0.0000
91 T A -0.6466
92 A A 0.0000
93 M A -0.1911
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 V A 0.0000
98 R A 0.0000
99 V A 0.0000
100 A A 0.0000
101 H A -1.9638
102 D A -1.9431
103 G A -1.1915
104 Y A -0.1159
105 Y A -0.0890
106 D A 0.0000
107 D A -0.1287
108 F A 0.4967
109 W A -0.4578
110 G A 0.0000
111 Q A -2.0214
112 G A 0.0000
113 T A -0.4931
114 T A 0.1615
115 V A 0.0000
116 T A 0.0503
117 V A 0.0000
118 S A -0.9511
119 S A -1.4416
120 G A -1.2046
121 G A -1.1078
122 G A -1.1244
123 G A -1.1436
124 S A -0.8775
125 G A -1.1080
126 G A -1.3636
127 G A -1.3560
128 G A -1.3798
129 S A -1.0363
130 G A -1.2731
131 G A -1.5855
132 G A -1.4380
133 G A -1.5525
134 S A -1.6072
135 D A -2.3656
136 I A 0.0000
137 E A -2.8764
138 L A 0.0000
139 T A -1.5260
140 Q A -1.0638
141 S A -0.7159
142 P A -0.3658
143 A A -0.3247
144 T A -0.4427
145 L A -0.3400
146 S A -0.7247
147 V A 0.0000
148 T A -1.3616
149 P A -1.7443
150 G A -1.8697
151 D A -2.3627
152 R A -2.8286
153 V A 0.0000
154 S A -0.7161
155 L A 0.0000
156 S A -0.9354
157 C A 0.0000
158 R A -2.9477
159 A A 0.0000
160 S A -2.2095
161 Q A -2.1986
162 S A -1.4471
163 I A 0.0000
164 S A -1.0188
165 D A -1.4160
166 Y A -0.2838
167 L A 0.0000
168 H A 0.0000
169 W A 0.0000
170 Y A 0.0000
171 Q A 0.0000
172 Q A 0.0000
173 K A -1.9184
174 S A -1.4339
175 H A -2.2992
176 E A -3.0386
177 S A -1.8078
178 P A 0.0000
179 R A -1.5412
180 L A 0.0000
181 L A 0.0000
182 I A 0.0000
183 K A -0.5786
184 Y A -0.5677
185 A A 0.0000
186 S A -1.0334
187 Q A -1.3531
188 S A -0.7502
189 I A -0.3069
190 S A -0.4300
191 G A -0.5380
192 I A 0.0000
193 P A -0.4038
194 S A -0.6047
195 R A -1.1168
196 F A 0.0000
197 S A -0.7155
198 G A 0.0000
199 S A -0.8941
200 G A -1.2664
201 S A -1.3077
202 G A -1.3651
203 S A -1.8770
204 D A -2.3195
205 F A 0.0000
206 T A -0.8180
207 L A 0.0000
208 S A -0.8271
209 I A 0.0000
210 N A -2.1908
211 S A -2.0537
212 V A 0.0000
213 E A -2.0293
214 P A -1.5764
215 E A -2.1415
216 D A 0.0000
217 V A -0.6670
218 G A 0.0000
219 V A -0.7390
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 Q A 0.0000
224 N A 0.0000
225 G A 0.0000
226 H A -0.2219
227 S A 0.0962
228 F A 0.8763
229 P A 0.0000
230 P A -0.2027
231 T A -0.8266
232 F A 0.0000
233 G A 0.0000
234 G A -1.9370
235 G A -1.1764
236 T A 0.0000
237 K A -1.0768
238 L A 0.0000
239 E A -0.9913
240 I A -0.8541
241 K A -1.6276
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8269 2.683 View CSV PDB
4.5 -0.8649 2.683 View CSV PDB
5.0 -0.908 2.683 View CSV PDB
5.5 -0.9476 2.683 View CSV PDB
6.0 -0.9742 2.683 View CSV PDB
6.5 -0.9822 2.683 View CSV PDB
7.0 -0.9729 2.683 View CSV PDB
7.5 -0.9515 2.683 View CSV PDB
8.0 -0.9221 2.683 View CSV PDB
8.5 -0.8862 2.683 View CSV PDB
9.0 -0.8451 2.683 View CSV PDB